GGTLC1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GGTLC1 Polyclonal antibody, PBS Only (17537-1-PBS)

• 

  WB analysis of HepG2 using 17537-1-AP (same clone as 17537-1-PBS)

  WB result of GGTLC1 antibody (17537-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-GGTLC1 transfected HepG2 cells. This data was developed using the same antibody clone with 17537-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 17537-1-AP (same clone as 17537-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 17537-1-AP (GGTLC1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17537-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 17537-1-AP (same clone as 17537-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using GGTLC1 antibody (17537-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 17537-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

GGTLC1 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 17537-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

Gamma-glutamyltransferase light chain 1, Gamma-glutamyltransferase-like activity 4, Gamma-glutamyltransferase-like protein 6, GGTL6, GGTLA4

---

Product Information

17537-1-PBS targets GGTLC1 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11592

  Product name: Recombinant human GGTLC1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-225 aa of BC040904

  Sequence: MTSEFFSAQLRAQISDDTTHPISYYKPEFYMPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILLNNEMDDFSSTSITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQVRMVVGAAGGTQITMATALAIIYNLWFGYDVKWAVEEPRLHNQLLPNVTTVERNIDQEVTAALETRHHHTQITSTFIAVVQAIVRMAGGWAAASDSRKGGEPAGY

• Full Name: gamma-glutamyltransferase light chain 1
• Calculated Molecular Weight: 225 aa, 24 kDa
• Observed Molecular Weight: 24 kDa
• GenBank Accession Number: BC040904
• Gene Symbol: GGTLC1
• Gene ID (NCBI): 92086
• RRID: AB_3669277
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BX51
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Gamma-glutamyltransferase light chain 1 (GGTLC1), initially named GGTL6, then GGTLA4, and later GGTLC1 in 2008, is a member of the gamma-glutamyl transferase (GGT) family. The most ubiquitously expressed human GGT gene, GGT1, encodes a single transmembrane polypeptide that is post-translationally processed to form a heavy and a light chain. Knockdown of GGTLC1 in Endometrial cancer (EC) cells was shown to induce G0/G1 phase arrest and apoptosis, underscoring the significance of GGTLC1 as a key regulator of these cellular processes in EC (PMID: 38841516).