Product Information
16296-1-PBS targets GHITM in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag9482 Product name: Recombinant human GHITM protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-72 aa of BC010354 Sequence: MLAARLVCLRTLPSRVFHPAFTKASPVVKNSITKNQWLLTPSREYATKTRIGIRRGRTGQELKEAALEPSME Predict reactive species |
| Full Name | growth hormone inducible transmembrane protein |
| Calculated Molecular Weight | 345 aa, 37 kDa |
| Observed Molecular Weight | 42 kDa, 25-27 kDa |
| GenBank Accession Number | BC010354 |
| Gene Symbol | GHITM |
| Gene ID (NCBI) | 27069 |
| RRID | AB_2111275 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9H3K2 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
GHITM, also known as MICS1, TMBIM5 or DERP2, is a mitochondrial protein which localizes in the inner membrane. GHITM is involved in mitochondrial morphology in specific cristae structures and the apoptotic release of cytochrome c from the mitochondria (PMID: 18417609). The gene of GHITM maps to chromosome 10q23.1, and encodes a 345-amino-acid protein with a calculated molecular mass of 37 kDa. The apparent molecular weight has been reported to be 42 kDa, the increased size in the protein may be due to post-translational modifications (PMID: 11416014; 16412389). GHITM can be cleaved into smaller forms of 23-27 kDa (PMID: 16412389; 18417609).















