GHITM Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GHITM Polyclonal antibody, PBS Only (16296-1-PBS)

• 

  WB analysis of mouse liver using 16296-1-AP (same clone as 16296-1-PBS)

  mouse liver mitochondria tissue were subjected to SDS PAGE followed by western blot with 16296-1-AP (GHITM antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16296-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse liver using 16296-1-AP (same clone as 16296-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 16296-1-AP (GHITM antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16296-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 16296-1-AP (same clone as 16296-1-PBS)

  WB results of GHITM antibody (16296-1-AP) with siRNA sample. This data was developed using the same antibody clone with 16296-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 16296-1-AP (same clone as 16296-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 16296-1-AP (GHITM antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16296-1-PBS in a different storage buffer formulation.

• 

  WB analysis of SH-SY5Y using 16296-1-AP (same clone as 16296-1-PBS)

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 16296-1-AP (GHITM antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16296-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 16296-1-AP (same clone as 16296-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 16296-1-AP (GHITM antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16296-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 16296-1-AP (same clone as 16296-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 16296-1-AP (GHITM antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16296-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 16296-1-AP (same clone as 16296-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using GHITM antibody (16296-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 16296-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

GHITM Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 16296-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

Dermal papilla-derived protein 2, DERP2, Growth hormone-inducible transmembrane protein, MICS1, My021

---

Product Information

16296-1-PBS targets GHITM in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9482

  Product name: Recombinant human GHITM protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-72 aa of BC010354

  Sequence: MLAARLVCLRTLPSRVFHPAFTKASPVVKNSITKNQWLLTPSREYATKTRIGIRRGRTGQELKEAALEPSME

• Full Name: growth hormone inducible transmembrane protein
• Calculated Molecular Weight: 345 aa, 37 kDa
• Observed Molecular Weight: 42 kDa, 25-27 kDa
• GenBank Accession Number: BC010354
• Gene Symbol: GHITM
• Gene ID (NCBI): 27069
• RRID: AB_2111275
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H3K2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GHITM, also known as MICS1, TMBIM5 or DERP2, is a mitochondrial protein which localizes in the inner membrane. GHITM is involved in mitochondrial morphology in specific cristae structures and the apoptotic release of cytochrome c from the mitochondria (PMID: 18417609). The gene of GHITM maps to chromosome 10q23.1, and encodes a 345-amino-acid protein with a calculated molecular mass of 37 kDa. The apparent molecular weight has been reported to be 42 kDa, the increased size in the protein may be due to post-translational modifications (PMID: 11416014; 16412389). GHITM can be cleaved into smaller forms of 23-27 kDa (PMID: 16412389; 18417609).