GIPR Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GIPR Polyclonal antibody, PBS Only (28322-1-PBS)

• 

  WB analysis using 28322-1-AP (same clone as 28322-1-PBS)

  HT-1080 cells were subjected to SDS PAGE followed by western blot with 28322-1-AP (GIPR antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28322-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 28322-1-AP (same clone as 28322-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 28322-1-AP (GIPR antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28322-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 28322-1-AP (same clone as 28322-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 28322-1-AP (GIPR antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28322-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 28322-1-AP (same clone as 28322-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 28322-1-AP (GIPR antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28322-1-PBS in a different storage buffer formulation.

GIPR Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 28322-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

Glucose-dependent insulinotropic polypeptide receptor, GIP-R, GIP R

---

Product Information

28322-1-PBS targets GIPR in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28143

  Product name: Recombinant human GIPR protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 401-466 aa of BC093723

  Sequence: SEIRRGWHHCRLRRSLGEEQRQLPERAFRALPSGSGPGEVPTSRGLSSGTLPGPGNEASRELESYC

• Full Name: gastric inhibitory polypeptide receptor
• Calculated Molecular Weight: 466 aa, 53 kDa
• Observed Molecular Weight: 53 kDa
• GenBank Accession Number: BC093723
• Gene Symbol: GIPR
• Gene ID (NCBI): 2696
• RRID: AB_2881113
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P48546
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GIPR, or Gastric Inhibitory Polypeptide Receptor, plays a crucial role in glucose metabolism and insulin secretion. It is a G protein-coupled receptor (GPCR). It belongs to the B1 class of this receptor family, which is involved in various physiological processes including fat generation, pancreatic beta-cell proliferation, and insulin release.