GIT2 Monoclonal antibody, PBS Only

• 

  WB analysis using 67858-1-Ig (same clone as 67858-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67858-1-Ig (GIT2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 67858-1-PBS in a different storage buffer formulation.

• 

  WB analysis of K-562 using 67858-1-Ig (same clone as 67858-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 67858-1-Ig (GIT2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67858-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HSC-T6 using 67858-1-Ig (same clone as 67858-1-PBS)

  HSC-T6 cells were subjected to SDS PAGE followed by western blot with 67858-1-Ig (GIT2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67858-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 67858-1-Ig (same clone as 67858-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 67858-1-Ig (GIT2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67858-1-PBS in a different storage buffer formulation.

GIT2 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 67858-1-PBS

Clone No.2D9C5

Host / Isotype

Mouse / IgG1

Reactivity

Human, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

ARF GAP GIT2, CAT 2, CAT2, DKFZp686G01261, GIT2, GRK interacting protein 2, KIAA0148

---

Product Information

67858-1-PBS targets GIT2 in WB, IHC, Indirect ELISA applications and shows reactivity with Human, rat samples.

• Tested Reactivity: Human, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0321

  Product name: Recombinant human GIT2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 254-462 aa of BC001379

  Sequence: DSSLDLSELAKAAKKKLQSLSNHLFEELAMDMYDEVDRRETDAVWLATQNHSALVTETTVVPFLPVNPEYSSTRNQGRQKLARFNAHEFATLVIDILSDAKRRQQGSSLSGSKDNVELILKTINNQHSVESQDNDQPDYDSVASDEDTDLETTASKTNRQKSLDSDLSDGPVTVQEFMEVKNALVASEAKIQQLMKVNNNLSDELRIMQ

• Full Name: G protein-coupled receptor kinase interacting ArfGAP 2
• Calculated Molecular Weight: 95 kDa
• Observed Molecular Weight: 70-85 kDa
• GenBank Accession Number: BC001379
• Gene Symbol: GIT2
• Gene ID (NCBI): 9815
• RRID: AB_2918616
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q14161
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.