GIT2 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• GIT2 Monoclonal antibody (67858-1-Ig)

• KD/KO Validated

GIT2 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 67858-1-Ig Copied!

Clone No. 2D9C5

Publications (1)

Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human, rat

Applications

WB, IHC, ELISA
For FC, select conjugated version.

Synonyms

2D9C5, ARF GAP GIT2, ARF GTPase-activating protein GIT2, CAT 2, CAT2

• 

  WB analysis using 67858-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67858-1-Ig (GIT2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 67858-1-Ig

  WB result of GIT2 antibody (67858-1-Ig; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-GIT2 transfected HEK-293 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of K-562 using 67858-1-Ig

  K-562 cells were subjected to SDS PAGE followed by western blot with 67858-1-Ig (GIT2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HSC-T6 using 67858-1-Ig

  HSC-T6 cells were subjected to SDS PAGE followed by western blot with 67858-1-Ig (GIT2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 67858-1-Ig

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 67858-1-Ig (GIT2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for GIT2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A549 cells, K-562 cells, HSC-T6 cells, HEK-293 cells, HeLa cells
• Positive IHC detected in: human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67858-1-Ig targets GIT2 in WB, IHC, ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0321

  Product name: Recombinant human GIT2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 254-462 aa of BC001379

  Sequence: DSSLDLSELAKAAKKKLQSLSNHLFEELAMDMYDEVDRRETDAVWLATQNHSALVTETTVVPFLPVNPEYSSTRNQGRQKLARFNAHEFATLVIDILSDAKRRQQGSSLSGSKDNVELILKTINNQHSVESQDNDQPDYDSVASDEDTDLETTASKTNRQKSLDSDLSDGPVTVQEFMEVKNALVASEAKIQQLMKVNNNLSDELRIMQ

• Full Name: G protein-coupled receptor kinase interacting ArfGAP 2
• Calculated Molecular Weight: 95 kDa
• Observed Molecular Weight: 70-85 kDa
• GenBank Accession Number: BC001379
• Gene Symbol: GIT2
• Gene ID (NCBI): 9815
• RRID: AB_2918616
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q14161
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The GIT2 Monoclonal antibody (2D9C5), catalog number 67858-1-Ig, has a total of 1 citation. It appears in Cancer Letters (Impact Factor 11.8), published in 2024. The cited study investigates how CD24 promotes metastasis and chemoresistance by directly targeting the Arf6-ERK pathway in esophageal squamous cell carcinoma, placing this citation within the fields of cancer biology, tumor metastasis, and chemoresistance.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cancer Lett; CD24 promotes metastasis and chemoresistance by directly targeting Arf6-ERK pathway in esophageal squamous cell carcinoma.; Authors - Pan Hong