Use Able AI chat for product recommendations

Gastrokine 1 Monoclonal antibody

Gastrokine 1 Monoclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 60130-1-Ig
Clone No. 3C10E3
Publications (1)
Review Product
Download datasheet

Host / Isotype

Mouse / IgG2a

Reactivity

human, rat, pig, mouse

Applications

WB, IHC, IF-P, ELISA

18 kDa antrum mucosa protein, AMP 18, AMP18, BRICD1, CA11, FOV, foveolin, gastrokine 1, GKN1, Protein CA11

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for Gastrokine 1 in ?

Tested Applications

Positive WB detected inhuman stomach tissue, rat stomach tissue
Positive IHC detected inhuman stomach tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman stomach tissue, mouse stomach tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

60130-1-Ig targets Gastrokine 1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, rat, pig, mouse samples.

Tested Reactivity human, rat, pig, mouse
Cited Reactivityhuman
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag6091

Product name: Recombinant human GKN1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 35-196 aa of BC059778

Sequence: NVNDDNNNAGSGQQSVSVNNEHNVANVDNNNGWDSWNSIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQSLDALVKEKKLQGKGPGGPPPKGLMYSVNPNKVDDLSKFGKNIANMCRGIPTYMAEEMQEASLFFYSGTCYTTSVLWIVDISFCGDTVEN

Predict reactive species
Full Name gastrokine 1
Calculated Molecular Weight 22 kDa
Observed Molecular Weight 22 kDa
GenBank Accession NumberBC059778
Gene Symbol Gastrokine 1
Gene ID (NCBI) 56287
RRIDAB_2111459
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9NS71
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Gastrokine 1 (GKN1), a stomach-specific protein also known as 18 kDa antrum mucosa protein (AMP-18) or foveolin, belongs to the gastrokine family of gastric mucus cell-secreted proteins. The human GKN1 gene has been localized in a region of chromosome 2p13 of about 6 kb and contains 6 exons. GKN1 is expressed only in normal human stomach, but is absent from gastric adenocarcinomas, gastro-esophageal adenocarcinoma cell lines, and other normal and tumor gastro-intestinal tissues. GKN1may play an important role in normal gastric function and may be a gastric tumour suppressor.

Protocols

Product Specific Protocols
IF protocol for Gastrokine 1 antibody 60130-1-IgDownload protocol
IHC protocol for Gastrokine 1 antibody 60130-1-IgDownload protocol
WB protocol for Gastrokine 1 antibody 60130-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The Gastrokine 1 (GKN1) Monoclonal Antibody (3C10E3), catalog number 60130-1-Ig, has a total of 1 citation. This citation appears in Gastro Hep Adv (2025), a journal focused on gastroenterology and hepatology. The associated research field involves esophageal disease modeling using microfluidic platforms for adult tissue-resident stem cell culture and differentiation. The antibody was applied in immunofluorescence (IF) on human samples.

SpeciesApplicationTitle
humanIF

Gastro Hep Adv

Advancing Esophageal Disease Modeling: Microfluidic Platforms for Adult Tissue-Resident Stem Cell Culture and Differentiation.

Authors - Sara Hosseini-Farahabadi
Loading...
||
New chat

Able™

正在加载,请稍候...