Gastrokine 1 Monoclonal antibody

• 

  WB analysis of human stomach using 60130-1-Ig

  human stomach tissue were subjected to SDS PAGE followed by western blot with 60130-1-Ig (GKN1 Antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat stomach using 60130-1-Ig

  rat stomach tissue were subjected to SDS PAGE followed by western blot with 60130-1-Ig (GKN1 Antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human stomach using 60130-1-Ig

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 60130-1-Ig (GKN1 Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human stomach using 60130-1-Ig

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 60130-1-Ig (GKN1 Antibody) at dilution of 1:200 (under 40x lens).

• 

  IF Staining of human stomach using 60130-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed human stomach tissue using Gastrokine 1 antibody (60130-1-Ig, Clone: 3C10E3 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L).

• 

  IF Staining of human stomach using 60130-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed human stomach tissue using Gastrokine 1 antibody (60130-1-Ig, Clone: 3C10E3 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L).

• 

  IF Staining of mouse stomach using 60130-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed mouse stomach tissue using Gastrokine 1 antibody (60130-1-Ig, Clone: 3C10E3 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L).

• 

  IF Staining of mouse stomach using 60130-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed mouse stomach tissue using Gastrokine 1 antibody (60130-1-Ig, Clone: 3C10E3 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L).

Gastrokine 1 Monoclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 60130-1-Ig

Clone No.3C10E3

Host / Isotype

Mouse / IgG2a

Reactivity

human, rat, pig, mouse

Applications

WB, IHC, IF-P, ELISA

Synonyms

18 kDa antrum mucosa protein, AMP 18, AMP18, BRICD1, CA11, FOV, foveolin, gastrokine 1, GKN1, Protein CA11

---

Tested Applications

• Positive WB detected in: human stomach tissue, rat stomach tissue
• Positive IHC detected in: human stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human stomach tissue, mouse stomach tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

60130-1-Ig targets Gastrokine 1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, rat, pig, mouse samples.

• Tested Reactivity: human, rat, pig, mouse
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6091

  Product name: Recombinant human GKN1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 35-196 aa of BC059778

  Sequence: NVNDDNNNAGSGQQSVSVNNEHNVANVDNNNGWDSWNSIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQSLDALVKEKKLQGKGPGGPPPKGLMYSVNPNKVDDLSKFGKNIANMCRGIPTYMAEEMQEASLFFYSGTCYTTSVLWIVDISFCGDTVEN

• Full Name: gastrokine 1
• Calculated Molecular Weight: 22 kDa
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: BC059778
• Gene Symbol: Gastrokine 1
• Gene ID (NCBI): 56287
• RRID: AB_2111459
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9NS71
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Gastrokine 1 (GKN1), a stomach-specific protein also known as 18 kDa antrum mucosa protein (AMP-18) or foveolin, belongs to the gastrokine family of gastric mucus cell-secreted proteins. The human GKN1 gene has been localized in a region of chromosome 2p13 of about 6 kb and contains 6 exons. GKN1 is expressed only in normal human stomach, but is absent from gastric adenocarcinomas, gastro-esophageal adenocarcinoma cell lines, and other normal and tumor gastro-intestinal tissues. GKN1may play an important role in normal gastric function and may be a gastric tumour suppressor.