CoraLite® Plus 488-conjugated Gastrokine 1 Monoclonal antibody

• 

  IF Staining of mouse stomach using CL488-60130

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse stomach tissue using CoraLite® Plus 488 Gastrokine 1 antibody (CL488-60130, Clone: 3C10E3 ) at dilution of 1:200. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse stomach using CL488-60130

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse stomach tissue using CoraLite® Plus 488 Gastrokine 1 antibody (CL488-60130, Clone: 3C10E3 ) at dilution of 1:200. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

Gastrokine 1 Monoclonal Antibody for IF-P

Cat No. CL488-60130

Clone No.3C10E3

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

IF-P

Synonyms

GKN1, CA11, BRICD1, AMP-18, AMP18

---

Tested Applications

• Positive IF-P detected in: mouse stomach tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-60130 targets Gastrokine 1 in IF-P applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6091

  Product name: Recombinant human GKN1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 35-196 aa of BC059778

  Sequence: NVNDDNNNAGSGQQSVSVNNEHNVANVDNNNGWDSWNSIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQSLDALVKEKKLQGKGPGGPPPKGLMYSVNPNKVDDLSKFGKNIANMCRGIPTYMAEEMQEASLFFYSGTCYTTSVLWIVDISFCGDTVEN

• Full Name: gastrokine 1
• Calculated Molecular Weight: 22 kDa
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: BC059778
• Gene Symbol: Gastrokine 1
• Gene ID (NCBI): 56287
• RRID: AB_2934425
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9NS71
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Gastrokine 1 (GKN1), a stomach-specific protein also known as 18 kDa antrum mucosa protein (AMP-18) or foveolin, belongs to the gastrokine family of gastric mucus cell-secreted proteins. The human GKN1 gene has been localized in a region of chromosome 2p13 of about 6 kb and contains 6 exons. GKN1 is expressed only in normal human stomach, but is absent from gastric adenocarcinomas, gastro-esophageal adenocarcinoma cell lines, and other normal and tumor gastro-intestinal tissues. GKN1may play an important role in normal gastric function and may be a gastric tumour suppressor.