CoraLite® Plus 488-conjugated Gastrokine 1 Monoclonal antibody

Gastrokine 1 Monoclonal Antibody for IF-P
Cat No. CL488-60130
Clone No.3C10E3

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

IF-P

GKN1, CA11, BRICD1, AMP-18, AMP18

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse stomach tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-60130 targets Gastrokine 1 in IF-P applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag6091

Product name: Recombinant human GKN1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 35-196 aa of BC059778

Sequence: NVNDDNNNAGSGQQSVSVNNEHNVANVDNNNGWDSWNSIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQSLDALVKEKKLQGKGPGGPPPKGLMYSVNPNKVDDLSKFGKNIANMCRGIPTYMAEEMQEASLFFYSGTCYTTSVLWIVDISFCGDTVEN

Predict reactive species
Full Name gastrokine 1
Calculated Molecular Weight 22 kDa
Observed Molecular Weight 22 kDa
GenBank Accession NumberBC059778
Gene Symbol Gastrokine 1
Gene ID (NCBI) 56287
RRIDAB_2934425
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9NS71
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Gastrokine 1 (GKN1), a stomach-specific protein also known as 18 kDa antrum mucosa protein (AMP-18) or foveolin, belongs to the gastrokine family of gastric mucus cell-secreted proteins. The human GKN1 gene has been localized in a region of chromosome 2p13 of about 6 kb and contains 6 exons. GKN1 is expressed only in normal human stomach, but is absent from gastric adenocarcinomas, gastro-esophageal adenocarcinoma cell lines, and other normal and tumor gastro-intestinal tissues. GKN1may play an important role in normal gastric function and may be a gastric tumour suppressor.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 Gastrokine 1 antibody CL488-60130Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...