Gastrokine 1 Monoclonal antibody, PBS Only

Gastrokine 1 Monoclonal Antibody for WB, IHC, IF-P, Indirect ELISA
Cat No. 60130-1-PBS
Clone No.3C10E3

Host / Isotype

Mouse / IgG2a

Reactivity

human, rat, pig, mouse

Applications

WB, IHC, IF-P, Indirect ELISA

18 kDa antrum mucosa protein, AMP 18, AMP18, BRICD1, CA11, FOV, foveolin, gastrokine 1, GKN1, Protein CA11

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

60130-1-PBS targets Gastrokine 1 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, rat, pig, mouse samples.

Tested Reactivity human, rat, pig, mouse
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag6091

Product name: Recombinant human GKN1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 35-196 aa of BC059778

Sequence: NVNDDNNNAGSGQQSVSVNNEHNVANVDNNNGWDSWNSIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQSLDALVKEKKLQGKGPGGPPPKGLMYSVNPNKVDDLSKFGKNIANMCRGIPTYMAEEMQEASLFFYSGTCYTTSVLWIVDISFCGDTVEN

Predict reactive species
Full Name gastrokine 1
Calculated Molecular Weight 22 kDa
Observed Molecular Weight 22 kDa
GenBank Accession NumberBC059778
Gene Symbol Gastrokine 1
Gene ID (NCBI) 56287
RRIDAB_2111459
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9NS71
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Gastrokine 1 (GKN1), a stomach-specific protein also known as 18 kDa antrum mucosa protein (AMP-18) or foveolin, belongs to the gastrokine family of gastric mucus cell-secreted proteins. The human GKN1 gene has been localized in a region of chromosome 2p13 of about 6 kb and contains 6 exons. GKN1 is expressed only in normal human stomach, but is absent from gastric adenocarcinomas, gastro-esophageal adenocarcinoma cell lines, and other normal and tumor gastro-intestinal tissues. GKN1may play an important role in normal gastric function and may be a gastric tumour suppressor.

Loading...
||
New chat Able
正在加载,请稍候...