GLCE Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GLCE Polyclonal antibody, PBS Only (33606-1-PBS)

• 

  WB analysis using 33606-1-AP (same clone as 33606-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 33606-1-AP (GLCE antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 33606-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 33606-1-AP (same clone as 33606-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 33606-1-AP (GLCE antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 33606-1-PBS in a different storage buffer formulation.

GLCE Polyclonal Antibody for WB, Indirect ELISA

Cat No. 33606-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

D-glucuronyl C5-epimerase, EC:5.1.3.17, Heparan sulfate C5-epimerase, Heparin/heparan sulfate:glucuronic acid C5-epimerase, Heparosan-N-sulfate-glucuronate 5-epimerase

---

Product Information

33606-1-PBS targets GLCE in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35424

  Product name: Recombinant human GLCE protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 29-200 aa of BC160046

  Sequence: NKCSSDKAIQFPRRSSSGFRVDGFEKRAAASESNNYMNHVAKQQSEEAFPQEQQKAPPVVGGFNSNVGSKVLGLKYEEIDCLINDEHTIKGRREGNEVFLPFTWVEKYFDVYGKVVQYDGYDRFEFSHSYSKVYAQRAPYHPDGVFMSFEGYNVEVRDRVKCISGVEGVPLS

• Full Name: glucuronic acid epimerase
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC160046
• Gene Symbol: GLCE
• Gene ID (NCBI): 26035
• RRID: AB_3743028
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: O94923
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GLCE encodes the C5-epimerase responsible for converting glucuronic acid to iduronic acid during heparan sulfate biosynthesis. Localized in the Golgi apparatus, it indirectly regulates growth factor signaling, angiogenesis, and cell-cell interactions through structural diversification of glycosaminoglycan chains. Dysregulation of GLCE has been associated with cancer progression and developmental abnormalities, highlighting its role at the interface of glycobiology and disease. (PMID: 24499487)