GLMN Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GLMN Polyclonal antibody, PBS Only (32645-1-PBS)

• 

  WB analysis using 32645-1-AP (same clone as 32645-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32645-1-AP (GLMN antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32645-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 32645-1-AP (same clone as 32645-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using GLMN antibody (32645-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 32645-1-PBS in a different storage buffer formulation.

GLMN Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 32645-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

FAP, FAP48, FAP68, FK506-binding protein-associated protein, FKBP-associated protein

---

Product Information

32645-1-PBS targets GLMN in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37763

  Product name: Recombinant human GLMN protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 241-594 aa of BC001257

  Sequence: ASEIIGFLSAIGHPFPKMIFNHGRKKRTWNYLEFEEEENKQLADSMASLAYLVFVQGIHIDQLPMVLSPLYLLQFNMGHIEVFLQRTEESVISKGLELLENSLLRIEDNSLLYQYLEIKSFLTVPQGLVKVMTLCPIETLRKKSLAMLQLYINKLDSQGKYTLFRCLLNTSNHSGVEAFIIQNIKNQIDMSLKRTRNNKWFTGPQLISLLDLVLFLPEGAETDLLQNSDRIMASLNLLRYLVIKDNENDNQTGLWTELGNIENNFLKPLHIGLNMSKAHYEAEIKNSQEAQKSKDLCSITVSGEEIPNMPPEMQLKVLHSALFTFDLIESVLARVEELIEIKTKSTSEENIGIK

• Full Name: glomulin, FKBP associated protein
• Calculated Molecular Weight: 68 kDa
• Observed Molecular Weight: 68 kDa
• GenBank Accession Number: BC001257
• Gene Symbol: GLMN
• Gene ID (NCBI): 11146
• RRID: AB_3742689
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q92990
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Glomulin (GLMN) is a regulatory component of cullin-RING-based SCF (SKP1-Cullin-F-box protein) E3 ubiquitin-protein ligase complexes (PMID: 22405651; 22748924). It inhibits E3 ubiquitin ligase activity by binding to RBX1 (via the RING domain) and inhibiting its interaction with the E2 ubiquitin-conjugating enzyme CDC34 (PMID: 22405651; 22748924). GLMN is essential for normal vasculature development and contributes to the regulation of RPS6KB1 phosphorylation (PMID: 11845407; 11571281).