Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

GLP1R Polyclonal antibody

GLP1R Polyclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 26196-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, IP, ELISA

GLP 1 R, GLP 1 receptor, GLP 1R, GLP-1 receptor, GLP-1R

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse pancreas tissue, rat pancreas tissue
Positive IHC detected inmouse pancreas tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse pancreas tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

26196-1-AP targets GLP1R in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag23529

Product name: Recombinant human GLP1R protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 26-145 aa of BC112126

Sequence: QGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY

Predict reactive species
Full Name glucagon-like peptide 1 receptor
Calculated Molecular Weight 463 aa, 53 kDa
Observed Molecular Weight 53 kDa
GenBank Accession NumberBC112126
Gene Symbol GLP1R
Gene ID (NCBI) 2740
RRIDAB_2880421
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP43220
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GLP1R (glucagon-like peptide-1 receptor) is a G protein-coupled receptor belonging to the secretin receptor super-family, also known as class B (PMID:34911028). GLP1R is widely distributed in pancreatic islets, muscles, gastrointestinal tract, lung, liver, pancreas, and other tissues or organs (PMID:35989517). Moreover, GLP1R agonist has been reported to induce autophagy of EC (Endometrial carcinoma) cells, and high GLP1R expression may be associated with good prognosis of EC patients, suggesting that GLP1R is likely to participate in the progression of EC (PMID:29907137). Natural GLP-1R is known to be N-glycosylated at positions 63, 82 and 115kDa(PMID: 36769142). Moreover, regarding the molecular weight of GLP1R, research shows that the bands at ~50 kDa and ~100 kDa belong to the monomer and dimer states of GLP1R (PMID: 28609478).

Protocols

Product Specific Protocols
IF protocol for GLP1R antibody 26196-1-APDownload protocol
IHC protocol for GLP1R antibody 26196-1-APDownload protocol
WB protocol for GLP1R antibody 26196-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
mouseWB

Int J Mol Sci

Geniposide Improves Diabetic Nephropathy by Enhancing ULK1-Mediated Autophagy and Reducing Oxidative Stress through AMPK Activation.

Authors - Theodomir Dusabimana
ratWB

Life Sci

Human gestational diabetes mellitus-derived exosomes impair glucose homeostasis in pregnant mice and stimulate functional maturation of offspring-islets

Authors - Linhai Zou
mouseWB

Biomed Pharmacother

Liraglutide, a glucagon-like peptide-1 receptor agonist, suppresses osteoclastogenesis through the inhibition of NF-κB and MAPK pathways via GLP-1R.

Authors - Ziyi Li
  • KD Validated
WB

Front Pharmacol

Novel Small Molecule Glucagon-Like Peptide-1 Receptor Agonist S6 Stimulates Insulin Secretion From Rat Islets.

Authors - Xiaohua Yang
ratWB

Front Pharmacol

A Potential Mechanism Underlying the Therapeutic Effects of Progesterone and Allopregnanolone on Ketamine-Induced Cognitive Deficits.

Authors - Ting Cao
ratWB

Front Endocrinol (Lausanne)

Clozapine Induced Disturbances in Hepatic Glucose Metabolism: The Potential Role of PGRMC1 Signaling.

Authors - Ting Cao

Reviews

    5.0 out of 5
Add a review

2 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Kenzo (Verified Customer) (08-16-2023)

This KO validated GLP-1R antibody generated specific robust signals in mouse pancreas tissue when used for immunofluorescence

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:500

Carly (Verified Customer) (11-17-2020)

Tested using EDTA plasma on an antibody microarray

  • Applications: Other
Loading...
||
New chat

Able

正在加载,请稍候...