Tested Applications
| Positive WB detected in | mouse pancreas tissue, rat pancreas tissue |
| Positive IHC detected in | mouse pancreas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse pancreas tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26196-1-AP targets GLP1R in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag23529 Product name: Recombinant human GLP1R protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 26-145 aa of BC112126 Sequence: QGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY Predict reactive species |
| Full Name | glucagon-like peptide 1 receptor |
| Calculated Molecular Weight | 463 aa, 53 kDa |
| Observed Molecular Weight | 53 kDa |
| GenBank Accession Number | BC112126 |
| Gene Symbol | GLP1R |
| Gene ID (NCBI) | 2740 |
| RRID | AB_2880421 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P43220 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
GLP1R (glucagon-like peptide-1 receptor) is a G protein-coupled receptor belonging to the secretin receptor super-family, also known as class B (PMID:34911028). GLP1R is widely distributed in pancreatic islets, muscles, gastrointestinal tract, lung, liver, pancreas, and other tissues or organs (PMID:35989517). Moreover, GLP1R agonist has been reported to induce autophagy of EC (Endometrial carcinoma) cells, and high GLP1R expression may be associated with good prognosis of EC patients, suggesting that GLP1R is likely to participate in the progression of EC (PMID:29907137). Natural GLP-1R is known to be N-glycosylated at positions 63, 82 and 115kDa(PMID: 36769142). Moreover, regarding the molecular weight of GLP1R, research shows that the bands at ~50 kDa and ~100 kDa belong to the monomer and dimer states of GLP1R (PMID: 28609478).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for GLP1R antibody 26196-1-AP | Download protocol |
| IHC protocol for GLP1R antibody 26196-1-AP | Download protocol |
| WB protocol for GLP1R antibody 26196-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The GLP-1R antibody (Cat# 26196-1-AP) has 42 citations. Journals include Cell Metab, J Am Chem Soc, Cell Rep, Life Sci, Diabetes Obes Metab, Biochem Pharmacol, Int J Mol Sci, Front Immunol, Exp Neurol, iScience, and others. Research fields span diabetes and metabolic disorders, cardiovascular disease (myocardial infarction, aortic aneurysm), neurology (Parkinson's, cognitive impairment), renal fibrosis, osteoarthritis, and cancer (hepatocellular carcinoma, cholangiocarcinoma). Applications are primarily WB, IF, IHC, and IP.
| Species | Application | Title |
|---|---|---|
J Am Chem Soc Affinity-Driven Aryl Diazonium Labeling of Peptide Receptors on Living Cells | ||
Cell Mol Biol Lett The promoting roles of GLP1R and GIPR in stemness maintenance and multiple lineage-specific differentiation of PDLSCs. | ||
J Orthop Translat Semaglutide alleviates osteoarthritis independent of weight loss via GLP-1R-mediated activation of autophagy through AKT/mTOR inhibition. | ||
Neural Regen Res The engineered probiotic strain Lactococcus lactis MG1363-pMG36e-GLP-1 regulates microglial polarization and gut dysbiosis in a transgenic mouse model of Parkinson's disease | ||
Antioxidants (Basel) Baicalein Ameliorates Insulin Resistance of HFD/STZ Mice Through Activating PI3K/AKT Signal Pathway of Liver and Skeletal Muscle in a GLP-1R-Dependent Manner | ||
Cell Rep Gut Bacteroides ovatus ameliorates renal fibrosis by promoting the production of HDCA through upregulation of Clostridium scindens
|
Reviews
What customers say
Both reviews rate the product 5 stars. One user reported that this KO-validated GLP-1R antibody produced specific, robust signals in mouse pancreas tissue at a 1:500 dilution for immunofluorescence. The other user confirmed successful performance when testing with EDTA plasma on an antibody microarray. Overall, customers express satisfaction with the antibody's specificity and versatility across different applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Kenzo (Verified Customer) (08-16-2023) | This KO validated GLP-1R antibody generated specific robust signals in mouse pancreas tissue when used for immunofluorescence
|
Carly (Verified Customer) (11-17-2020) | Tested using EDTA plasma on an antibody microarray
|
