GLRX Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GLRX Polyclonal antibody, PBS Only (15804-1-PBS)

• 

  WB analysis using 15804-1-AP (same clone as 15804-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15804-1-AP (GLRX antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15804-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 15804-1-AP (same clone as 15804-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15804-1-AP (GLRX antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15804-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse lung using 15804-1-AP (same clone as 15804-1-PBS)

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 15804-1-AP (GLRX antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15804-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 15804-1-AP (same clone as 15804-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HepG2 cells using GLRX antibody (15804-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 15804-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

GLRX Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 15804-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

Glutaredoxin 1, Glrx1, Glutaredoxin-1, Thioltransferase-1, TTase-1

---

Product Information

15804-1-PBS targets GLRX in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8535

  Product name: Recombinant human GLRX protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-106 aa of BC005304

  Sequence: MAQEFVNCKIQPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDYLQQLTGARTVPRVFIGKDCIGGCSDLVSLQQSGELLTRLKQIGALQ

• Full Name: glutaredoxin (thioltransferase)
• Calculated Molecular Weight: 106 aa, 12 kDa
• Observed Molecular Weight: 12 kDa
• GenBank Accession Number: BC005304
• Gene Symbol: GLRX
• Gene ID (NCBI): 2745
• RRID: AB_11232210
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P35754
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.