GLRX3 Recombinant monoclonal antibody, PBS Only (Capture)

• 

  WB analysis using 86587-1-RR (same clone as 86587-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86587-1-RR (GLRX3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86587-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array sample test of MP02531-1

  The mean GLRX3 concentration was determined to be 669.5 ng/mL in HEK-293 cell extract based on a 1.1 mg/mL extract load, 358.1 ng/mL in A549 cell extract based on a 1.2 mg/mL extract load.

• 

  Cytometric bead array standard curve of MP02531-1

  Cytometric bead array standard curve of MP02531-1, GLRX3 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 86587-1-PBS. Detection antibody: 86587-2-PBS. Standard: Ag1775. Range: 1.562-100 ng/mL.

• 

  Affinity and Kinetic Characterization of 86587-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86587-1-RR against Human GLRX3 were performed. The affinity constant is 3.76 nM.

GLRX3 Uni-rAb^® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA

Cat No. 86587-1-PBS

Clone No.251530F9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Cytometric bead array, Indirect ELISA

Synonyms

Glutaredoxin 3, GLRX4, Glutaredoxin-3, GRX3, GRX4

---

Product Information

86587-1-PBS targets GLRX3 as part of a matched antibody pair:

MP02531-1: 86587-1-PBS capture and 86587-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1775

  Product name: Recombinant human GLRX3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-289 aa of BC014372

  Sequence: AQMNEVMAELAKELPQVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHASSGSFLSSANEHLKEDLNLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQFSSFDIFSDEEVRQGLKAYSSWPTYPQLYVSGELIGGLDIIKELEASEELDTICPKAPKLEERLKVLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDILEDEEVRQGLKAYSNWPTYPQLYVKGELVGGLDIVKELKENGELLPILRGEN

• Full Name: glutaredoxin 3
• Calculated Molecular Weight: 37 kDa
• Observed Molecular Weight: 37-40 kDa
• GenBank Accession Number: BC014372
• Gene Symbol: GLRX3
• Gene ID (NCBI): 10539
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O76003
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GLRX3(Glutaredoxin-3) is also named as PICOT, TXNL2. Mammalian glutaredoxin 3 is an essential protein involved in the regulation of signal transduction, for instance during immune cell activation and development of cardiac hypertrophy, presumably in response to redox signals(PMID:20226171). Glrx3 could take a pivotal role in colon and lung cancer cells during the tumorigenesis, which is expressed in lung and colon cancers consistently and preferentially(PMID:19797004).