GLRX3 Recombinant monoclonal antibody

• 

  WB analysis using 86587-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86587-1-RR (GLRX3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  Affinity and Kinetic Characterization of 86587-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86587-1-RR against Human GLRX3 were performed. The affinity constant is 3.76 nM.

GLRX3 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 86587-1-RR

Clone No.251530F9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

Glutaredoxin 3, GLRX4, Glutaredoxin-3, GRX3, GRX4

---

Tested Applications

• Positive WB detected in: MCF-7 cells, A549 cells, Raji cells, Jurkat cells, mouse testis tissue, rat testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86587-1-RR targets GLRX3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1775

  Product name: Recombinant human GLRX3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-289 aa of BC014372

  Sequence: AQMNEVMAELAKELPQVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHASSGSFLSSANEHLKEDLNLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQFSSFDIFSDEEVRQGLKAYSSWPTYPQLYVSGELIGGLDIIKELEASEELDTICPKAPKLEERLKVLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDILEDEEVRQGLKAYSNWPTYPQLYVKGELVGGLDIVKELKENGELLPILRGEN

• Full Name: glutaredoxin 3
• Calculated Molecular Weight: 37 kDa
• Observed Molecular Weight: 37-40 kDa
• GenBank Accession Number: BC014372
• Gene Symbol: GLRX3
• Gene ID (NCBI): 10539
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O76003
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GLRX3(Glutaredoxin-3) is also named as PICOT, TXNL2. Mammalian glutaredoxin 3 is an essential protein involved in the regulation of signal transduction, for instance during immune cell activation and development of cardiac hypertrophy, presumably in response to redox signals(PMID:20226171). Glrx3 could take a pivotal role in colon and lung cancer cells during the tumorigenesis, which is expressed in lung and colon cancers consistently and preferentially(PMID:19797004).