GLS2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GLS2 Polyclonal antibody, PBS Only (20171-1-PBS)

• 

  WB analysis using 20171-1-AP (same clone as 20171-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 20171-1-AP (GLS2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20171-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 20171-1-AP (same clone as 20171-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 20171-1-AP (GLS2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20171-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 20171-1-AP (same clone as 20171-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 20171-1-AP (GLS2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20171-1-PBS in a different storage buffer formulation.

GLS2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 20171-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

20171-1-PBS targets GLS2 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14003

  Product name: Recombinant human GLS2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-61 aa of BC059370

  Sequence: MRSMKALQKALSRAGSHCGRGGWGHPSRSPLLGGGVRHHLSEAAAQGRETPHSHQPQHQDQ

• Full Name: glutaminase 2 (liver, mitochondrial)
• Calculated Molecular Weight: 602 aa, 66 kDa
• Observed Molecular Weight: 66-70 kDa
• GenBank Accession Number: BC059370
• Gene Symbol: GLS2
• Gene ID (NCBI): 27165
• RRID: AB_3085600
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UI32
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GLS2, also named as GA and GLS, belongs to the glutaminase family. It is Glutaminase liver isoform . GLS2 plays an important role in the regulation of glutamine catabolism. It promotes mitochondrial respiration and increases ATP generation in cells by catalyzing the synthesis of glutamate and alpha-ketoglutarate. GLS2 may play a role in preventing tumor proliferation. This antibody is specific to GLS2.