GLYR1 Recombinant monoclonal antibody

• 

  WB analysis using 86877-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86877-1-RR (N-PAC antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HeLa using 86877-1-RR

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using N-PAC antibody (86877-1-RR, Clone: 251890G7 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  Affinity of 86877-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86877-1-RR against Human GLYR1 were performed. The affinity constant is 0.332 nM.

GLYR1 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 86877-1-RR

Clone No.251890G7

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, IF/ICC, ELISA

Synonyms

3-hydroxyisobutyrate dehydrogenase-like protein, Cytokine-like nuclear factor N-PAC, Glyoxylate reductase 1 homolog, HIBDL, hNDF

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86877-1-RR targets GLYR1 in WB, IF/ICC, ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag6637

  Product name: Recombinant human N-PAC protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 133-484 aa of BC064940

  Sequence: WQPTASEPVKDADPHFHHFLLSQTEKPAVCYQAITKKLKICEEETGSTSIQAADSTAVNGSITPTDKKIGFLGLGLMGSGIVSNLLKMGHTVTVWNRTAEKCDLFIQEGARLGRTPAEVVSTCDITFACVSDPKAAKDLVLGPSGVLQGIRPGKCYVDMSTVDADTVTELAQVIVSRGGRFLEAPVSGNQQLSNDGMLVILAAGDRGLYEDCSSCFQAMGKTSFFLGEVGNAAKMMLIVNMVQGSFMATIAEGLTLAQVTGQSQQTLLDILNQGQLASIFLDQKCQNILQGNFKPDFYLKYIQKDLRLAIALGDAVNHPTPMAAAANEVYKRAKALDQSDNDMSAVYRAYIH

• Full Name: cytokine-like nuclear factor n-pac
• Calculated Molecular Weight: 61 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC064940
• Gene Symbol: N-PAC
• Gene ID (NCBI): 84656
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q49A26
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GlyR1 (glyoxylate/successful semi-Aldehyde Reductase 1) is a plant-specific NADPH- dependent reductase, which mainly locates in cytoplasm. It was originally regarded as "glyoxal/succinate semialdehyde reductase", which can reduce glyoxylate, an intermediate product of photorespiration, to glycolate, and also reduce succinate semialdehyde produced by GABA metabolism to γ-hydroxybutyric acid, thus eliminating active aldehydes and alleviating oxidative damage caused by abiotic stress. In invasive breast cancer cells, GLYR1 was detected to "flip" from the nucleus to the cell membrane (ecto-GLYR1) and became a new tumor-specific antigen. Humanized antibody and CAR-NK/CAR-T systems have been established for the membrane epitope, and will soon enter the clinical safety assessment. This means that GLYR1 itself can also be used as a "membrane target antigen" for precise tumor treatment.