GMEB2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GMEB2 Polyclonal antibody, PBS Only (13314-1-PBS)

• 

  WB analysis of human placenta using 13314-1-AP (same clone as 13314-1-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 13314-1-AP (GMEB2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13314-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse thymus using 13314-1-AP (same clone as 13314-1-PBS)

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 13314-1-AP (GMEB2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13314-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse ovary using 13314-1-AP (same clone as 13314-1-PBS)

  mouse ovary tissue were subjected to SDS PAGE followed by western blot with 13314-1-AP (GMEB2 antibody) at dilution of 1:0 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13314-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human cervical cancer using 13314-1-AP (same clone as 13314-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human cervical cancer using 13314-1-AP (GMEB2 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 13314-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human cervical cancer using 13314-1-AP (same clone as 13314-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human cervical cancer using 13314-1-AP (GMEB2 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 13314-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 13314-1-AP (same clone as 13314-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using GMEB2 antibody (13314-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 13314-1-PBS in a different storage buffer formulation.

GMEB2 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 13314-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

P79PIF, KIAA1269, GMEB-2, GMEB 2, Glucocorticoid modulatory element-binding protein 2

---

Product Information

13314-1-PBS targets GMEB2 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4157

  Product name: Recombinant human GMEB2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-304 aa of BC036305

  Sequence: MATPDVSVHMEEVVVVTTPDTAVDGSGVEGVKTVLVTTNLAPHGGDLTEDNMETENAAAAAAAAFTASSQLKEAVLVKMAEEGENLEAEIVYPITCGDSRANLIWRKFVCPGINVKCVQYDEHVISPKEFVHLAGKSTLKDWKRAIRMNGIMLRKIMDSGELDFYQHDKVCSNTCRSTKIDLSGARVSLSSPTSAEYIPLTPAAADVNGSPATITIETCEDPGDWTAAIGDDTFTFWRGLKDAGLLDEVIQEFHQELVETMRGLQQRVQDPPLQLRDAVLLNNIVQNFGMLDLVKKVLASHKCQ

• Full Name: glucocorticoid modulatory element binding protein 2
• Calculated Molecular Weight: 530 aa, 56 kDa
• Observed Molecular Weight: 65-70 kDa
• GenBank Accession Number: BC036305
• Gene Symbol: GMEB2
• Gene ID (NCBI): 26205
• RRID: AB_2110829
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UKD1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GMEB2, also named as Glucocorticoid modulatory element-binding protein 2, is a 530 amino acid protein, which is expressed in peripheral blood lymphocytes and fetal liver. GMEB2 as a trans-acting factor that binds to glucocorticoid modulatory elements (GME) present in the TAT (tyrosine aminotransferase) promoter and increases sensitivity to low concentrations of glucocorticoids. The calcualted molecular weight of GMEB2 is 56 kDa, but modified GMEB2 is about 65-70 kDa.