GNMT Monoclonal antibody

• 

  WB analysis using 67294-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67294-1-Ig (GNMT antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 67294-1-Ig

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 67294-1-Ig (GNMT antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of pig liver using 67294-1-Ig

  pig liver tissue were subjected to SDS PAGE followed by western blot with 67294-1-Ig (GNMT antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat liver using 67294-1-Ig

  rat liver tissue were subjected to SDS PAGE followed by western blot with 67294-1-Ig (GNMT antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of A431 using 67294-1-Ig

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using GNMT antibody (67294-1-Ig, Clone: 1B5E3 ) at dilution of 1:800 and CoraLite®594-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

• 

  IF Staining of A431 using 67294-1-Ig

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using GNMT antibody (67294-1-Ig, Clone: 1B5E3 ) at dilution of 1:800 and CoraLite®594-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

GNMT Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 67294-1-Ig

Clone No.1B5E3

Publications(2)

Reviews (1)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

EC:2.1.1.20, glycine N methyltransferase, Glycine N-methyltransferase

---

Tested Applications

• Positive WB detected in: rat liver tissue, pig liver tissue, mouse liver tissue, rat pancreas tissue, mouse pancreas tissue
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IHC: See 1 publications below

Product Information

67294-1-Ig targets GNMT in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4598

  Product name: Recombinant human GNMT protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-295 aa of BC032627

  Sequence: MVDSVYRTRSLGVAAEGLPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCQRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRHEPAFDKWVIEEANWMTLDKDVPQSAEGGFDAVICLGNSFAHLPDCKGDQSEHRLALKNIASMVRAGGLLVIDHRNYDHILSTGCAPPGKNIYYKSDLTKDVTTSVLIVNNKAHMVTLDYTVQVPGAGQDGSPGLSKFRLSYYPHCLASFTELLQAAFGGKCQHSVLGDFKPYKPGQTYIPCYFIHVLKRTD

• Full Name: glycine N-methyltransferase
• Calculated Molecular Weight: 295 aa, 33 kDa
• Observed Molecular Weight: 33 kDa
• GenBank Accession Number: BC032627
• Gene Symbol: GNMT
• Gene ID (NCBI): 27232
• RRID: AB_2882559
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q14749
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Glycine N-methyltransferase (GNMT, EC 2.1.1.20) was found originally as an enzyme regulating the ratio of SAM to S-adenosyl- homocysteine. GNMT is conservative among different animal species. Glycine-N methyltransferase (GNMT) is a potential tumor suppressor that is commonly inactivated in human hepatoma. GNMT is abundant in liver, but very low in HepG2 cells (PMID: 12566990).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Front Oncol; Mining of RNA Methylation-Related Genes and Elucidation of Their Molecular Biology in Gallbladder Carcinoma.; Authors - Changhong Yang
human	WB	Cell Biochem Biophys; Brucine Suppresses Malignant Progression of Prostate Cancer by Decreasing Sarcosine Accumulation via Downregulation of GNMT in the Glycine/sarcosine Metabolic Pathway; Authors - Long Miao

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Hua (Verified Customer) (11-11-2022)

Great antibody for WB. Strong signal and clean background.

• Applications: Western Blot
• Primary Antibody Dilution: 1:8000
• Cell Tissue Type: Mouse liver

GNMT Antibody Western Blot validation (1:8000 dilution) in Mouse liver (Cat no:67294-1-Ig)