GNS Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GNS Polyclonal antibody, PBS Only (13044-1-PBS)

• 

  WB analysis of PC-3 using 13044-1-AP (same clone as 13044-1-PBS)

  PC-3 cells were subjected to SDS PAGE followed by western blot with 13044-1-AP (GNS antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13044-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 13044-1-AP (same clone as 13044-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 13044-1-AP (GNS antibody) at dilution of 1:0 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13044-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 13044-1-AP (same clone as 13044-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 13044-1-AP (GNS antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 13044-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 13044-1-AP (same clone as 13044-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 13044-1-AP (GNS antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 13044-1-PBS in a different storage buffer formulation.

• 

  IF Staining of PC-3 using 13044-1-AP (same clone as 13044-1-PBS)

  Immunofluorescent analysis of (-20℃ Ethanol) fixed PC-3 cells using 13044-1-AP (GNS antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 13044-1-PBS in a different storage buffer formulation.

GNS Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 13044-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

13044-1-PBS targets GNS in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3712

  Product name: Recombinant human GNS protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 200-552 aa of BC012482

  Sequence: SVDYLTDVLANVSLDFLDYKSNFEPFFMMIATPAPHSPWTAAPQYQKAFQNVFAPRNKNFNIHGTNKHWLIRQAKTPMTNSSIQFLDNAFRKRWQTLLSVDDLVEKLVKRLEFTGELNNTYIFYTSDNGYHTGQFSLPIDKRQLYEFDIKVPLLVRGPGIKPNQTSKMLVANIDLGPTILDIAGYDLNKTQMDGMSLLPILRGASNLTWRSDVLVEYQGEGRNVTDPTCPSLSPGVSQCFPDCVCEDAYNNTYACVRTMSALWNLQYCEFDDQEVFVEVYNLTADPDQITNIAKTIDPELLGKMNYRLMMLQSCSGPTCRTPGVFDPGYRFDPRLMFSNRGSVRTRRFSKHLL

• Full Name: glucosamine (N-acetyl)-6-sulfatase
• Calculated Molecular Weight: 552 aa, 62 kDa
• Observed Molecular Weight: 94 kDa
• GenBank Accession Number: BC012482
• Gene Symbol: GNS
• Gene ID (NCBI): 2799
• RRID: AB_2115308
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P15586
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.