GOLIM4 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GOLIM4 Polyclonal antibody, PBS Only (31083-1-PBS)

• 

  WB analysis using 31083-1-AP (same clone as 31083-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31083-1-AP (GOLIM4 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31083-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 31083-1-AP (same clone as 31083-1-PBS)

  WB result of GOLIM4 antibody (31083-1-AP; 1:30000; incubated at room temperature for 1.5 hours) with sh-Control and sh-GOLIM4 transfected HEK-293 cells. This data was developed using the same antibody clone with 31083-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 31083-1-AP (same clone as 31083-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 31083-1-AP (GOLIM4 antibody) at dilution of 1:2000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31083-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 31083-1-AP (same clone as 31083-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 31083-1-AP (GOLIM4 antibody) at dilution of 1:2000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31083-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 31083-1-AP (same clone as 31083-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using GOLIM4 antibody (31083-1-AP) at dilution of 1:600 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red). This data was developed using the same antibody clone with 31083-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 31083-1-AP (same clone as 31083-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using GOLIM4 antibody (31083-1-AP) at dilution of 1:600 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CoraLite®594-Phalloidin (red). This data was developed using the same antibody clone with 31083-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

GOLIM4 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 31083-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

GIMPC, GOLPH4, GPP130, P 138, P138

---

Product Information

31083-1-PBS targets GOLIM4 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34962

  Product name: Recombinant human GOLIM4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 350-500 aa of NM_014498

  Sequence: QVGQAEHLEEEHDPSPEEQDREWKEQHEQREAANLLEGHARAEVYPSAKPMIKFQSPYEEQLEQQRLAVQQVEEAQQLREHQEALHQQRLQGHLLRQQEQQQQQVAREMALQRQAELEEGRPQHQEQLRQQAHYDAMDNDIVQGAEDQGIQ

• Full Name: golgi integral membrane protein 4
• Calculated Molecular Weight: 82 kDa
• Observed Molecular Weight: 130 kDa
• GenBank Accession Number: NM_014498
• Gene Symbol: GOLIM4
• Gene ID (NCBI): 27333
• RRID: AB_3669846
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: O00461
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Golgi integral membrane protein 4 (GOLIM4) is a 130-kDa membrane protein that is integrated into the cis/medial Golgi apparatus, which is a kind II Golgi protein. GOLIM4 is a Golgi protein that circulates between Golgi apparatus and endosomes, and its shuttle is pH sensitive(PMID:30068697).