GOPC Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GOPC Polyclonal antibody, PBS Only (12163-1-PBS)

• 

  WB analysis using 12163-1-AP (same clone as 12163-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 12163-1-AP (GOPC antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12163-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 12163-1-AP (same clone as 12163-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 12163-1-AP (GOPC antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12163-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 12163-1-AP (same clone as 12163-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 12163-1-AP (GOPC antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12163-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat kidney using 12163-1-AP (same clone as 12163-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 12163-1-AP (GOPC antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12163-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 12163-1-AP (same clone as 12163-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer using 12163-1-AP (GOPC antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 12163-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HEK-293T using 12163-1-AP (same clone as 12163-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HEK-293T cells using GOPC antibody (12163-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 12163-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HEK-293 using 12163-1-AP (same clone as 12163-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HEK-293 cells using GOPC antibody (12163-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 12163-1-PBS in a different storage buffer formulation.

GOPC Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 12163-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

CAL, CFTR-associated ligand, FIG, Golgi-associated PDZ and coiled-coil motif-containing protein, GOPC1

---

Product Information

12163-1-PBS targets GOPC in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2804

  Product name: Recombinant human GOPC protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-370 aa of BC009553

  Sequence: MSAGGPCPAAAGGGPGGASCSVGAPGGVSMFRWLEVLEKEFDKAFVDVDLLLGEIDPDQADITYEGRQKMTSLSSCFAQLCHKAQSVSQINHKLEAQLVDLKSELTETQAEKVVLEKEVHDQLLQLHSIQLQLHAKTGQSADSGTIKAKLERELEANKKEKMKEAQLEAEVKLLRKENEALRRHIAVLQAEVYGARLAAKYLDKELAGRVQQIQLLGRDMKGPAHDKLWNQLEAEIHLHRHKTVIRACRGRNDLKRPMQAPPGHDQDSLKKSQGVGPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYVAPEVDSDD

• Full Name: golgi associated PDZ and coiled-coil motif containing
• Calculated Molecular Weight: 454 aa, 50 kDa
• Observed Molecular Weight: 50-55 kDa
• GenBank Accession Number: BC009553
• Gene Symbol: GOPC
• Gene ID (NCBI): 57120
• RRID: AB_2113182
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HD26
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GOPC (FIG/PIST/CAL) is a PDZ-domain scaffolding protein that regulates the trafficking of many integral membrane proteins, including cell surface receptors, ion channels and adhesion molecules. GOPC localizes to the trans-Golgi network (TGN) but not to the cis- or trans-Golgi cisternae, thus anti-GOPC can be used to label the TGN structure.