CoraLite®594-conjugated GOSR2/Membrin Monoclonal antibody

• 

  IF Staining of human liver cancer using CL594-66134

  Immunofluorescent analysis of (4% PFA) fixed human liver cancer tissue using CoraLite®594 GOSR2/Membrin antibody (CL594-66134, Clone: 7E7C7 ) at dilution of 1:100.

• 

  IF Staining of human liver cancer using CL594-66134

  Immunofluorescent analysis of (4% PFA) fixed human liver cancer tissue using CoraLite®594 GOSR2/Membrin antibody (CL594-66134, Clone: 7E7C7 ) at dilution of 1:100.

• Featured Product
• KD/KO Validated

GOSR2/Membrin Monoclonal Antibody for IF-P

Cat No. CL594-66134

Clone No.7E7C7

Host / Isotype

Mouse / IgG2a

Reactivity

human, rat

Applications

IF-P

Synonyms

27 kDa Golgi SNARE protein, Bos1, GOSR2, GOSR2/Membrin, GS27, Membrin

---

Tested Applications

• Positive IF-P detected in: human liver cancer tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66134 targets GOSR2/Membrin in IF-P applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21393

  Product name: Recombinant human GOSR2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-192 aa of BC009710

  Sequence: MDPLFQQTHKQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNDSDTTIPMDESLQFNSSLQKVHNGMDDLILDGHNILDGLRTQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDKYF

• Full Name: golgi SNAP receptor complex member 2
• Calculated Molecular Weight: 212 aa, 25 kDa
• Observed Molecular Weight: 25 kDa
• GenBank Accession Number: BC009710
• Gene Symbol: Membrin
• Gene ID (NCBI): 9570
• RRID: AB_2919952
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O14653
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Golgi SNAP receptor complex member 2 (GOSR2), also known as GS27 or Membrin, is a member of the solube NSF attachment protein receptor (SNARE) family of vesicle docking proteins. GOSR2 is localized in Golgi apparatus. It is involved in transport of proteins from the cis/medial-Golgi to the trans-Golgi network.