GPD1 Polyclonal antibody, PBS Only

• 

  WB analysis of rat liver using 27943-1-AP (same clone as 27943-1-PBS)

  rat liver tissue were subjected to SDS PAGE followed by western blot with 27943-1-AP (GPD1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27943-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse liver using 27943-1-AP (same clone as 27943-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 27943-1-AP (GPD1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27943-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

GPD1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 27943-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

27943-1-PBS targets GPD1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27703

  Product name: Recombinant human GPD1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 40-181 aa of BC032234

  Sequence: VFEEDIGGKKLTEIINTQHENVKYLPGHKLPPNVVAVPDVVQAAEDADILIFVVPHQFIGKICDQLKGHLKANATGISLIKGVDEGPNGLKLISEVIGERLGIPMSVLMGANIASEVADEKFCETTIGCKDPAQGQLLKELM

• Full Name: glycerol-3-phosphate dehydrogenase 1 (soluble)
• Calculated Molecular Weight: 349 aa, 38 kDa
• Observed Molecular Weight: 32-42 kDa
• GenBank Accession Number: BC032234
• Gene Symbol: GPD1
• Gene ID (NCBI): 2819
• RRID: AB_2881016
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P21695
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.