GPX1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GPX1 Polyclonal antibody, PBS Only (29329-1-PBS)

• 

  WB analysis using 29329-1-AP (same clone as 29329-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29329-1-AP (GPX1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29329-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 29329-1-AP (same clone as 29329-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29329-1-AP (GPX1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29329-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 29329-1-AP (same clone as 29329-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29329-1-AP (GPX1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29329-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

GPX1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 29329-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

29329-1-PBS targets GPX1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31101

  Product name: Recombinant human GPX1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 102-203 aa of BC000742

  Sequence: GGGFEPNFMLFEKCEVNGAGAHPLFAFLREALPAPSDDATALMTDPKLITWSPVCRNDVAWNFEKFLVGPDGVPLRRYSRRFQTIDIEPDIEALLSQGPSCA

• Full Name: glutathione peroxidase 1
• Calculated Molecular Weight: 22 kDa
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: BC000742
• Gene Symbol: GPX1
• Gene ID (NCBI): 2876
• RRID: AB_2918283
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P07203
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Gpx protein, known as selenoprotein, consists selenium in its catalytic site. Gpx1 is an abundant isoform, which involves in scavenging endogenous ROS using electron provided by reduced glutathione and ubiquitously expressed the cytoplasm and mitochondria of all cell types. (PMID: 30632027)