GRAMD1B Polyclonal antibody

• Home
• Products
• Primary Antibodies
• GRAMD1B Polyclonal antibody (24905-1-AP)

• Featured Product
• KD/KO Validated

GRAMD1B Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 24905-1-AP Copied!

Publications (10)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

Synonyms

GRAM domain containing 1B, GRAM domain-containing protein 1B, KIAA1201, Protein Aster-B, UNQ3032/PRO9834

• 

  WB analysis of A549 using 24905-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 24905-1-AP (GRAMD1B Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 24905-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 24905-1-AP (GRAMD1B Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 24905-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 24905-1-AP (GRAMD1B Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of A549 using 24905-1-AP

  Immunofluorescent analysis of (10% Formaldehyde) fixed A549 cells using 24905-1-AP (GRAMD1B antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of A549 using 24905-1-AP

  1X10^6 A549 cells were intracellularly stained with 0.4 ug Anti-Human GRAMD1B (24905-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for GRAMD1B in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A549 cells
• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A549 cells
• Positive FC (Intra) detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24905-1-AP targets GRAMD1B in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20670

  Product name: Recombinant human GRAMD1B protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 235-504 aa of BC107480

  Sequence: YVPPDDDFNTMGYCEEIPVEENEVNDSSSKSSIETKPDASPQLPKKSITNSTLTSTGSSEAPVSFDGLPLEEEALEGDGSLEKELAIDNIMGEKIEMIAPVNSPSLDFNDNEDIPTELSDSSDTHDEGEVQAFYEDLSGRQYVNEVFNFSVDKLYDLLFTNSPFQRDFMEQRRFSDIIFHPWKKEENGNQSRVILYTITLTNPLAPKTATVRETQTMYKASQESECYVIDAEVLTHDVPYHDYFYTINRYTLTRVARNKSRLRVSTELRY

• Full Name: GRAM domain containing 1B
• Calculated Molecular Weight: 738 aa, 85 kDa
• Observed Molecular Weight: 85 kDa
• GenBank Accession Number: BC107480
• Gene Symbol: GRAMD1B
• Gene ID (NCBI): 57476
• RRID: AB_2879791
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q3KR37
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GRAMD1B, also named as KIAA1201, contains a transmembrane region and two domains of known function; the GRAM domain and a VASt domain. It is predicted to localize in the nucleus, supported by several nuclear transport signals and nuclearly associated motifs. This highly conserved gene is found in a variety of vertebrates and invertebrates, however, it is not found in bacteria or fungi. There're some isoforms with MW 50 kDa and 81-87 kDa. With phosphor modification, it's about 90-110 kDa in WB detection.

Publications

What published studies show

The antibody targeting ASTER-B (GRAMD1B), catalog number 24905-1-AP, has a total of 10 citations. These appear in journals including Nature Cell Biology, Nature Communications, Biological Psychiatry, Antioxidants, Molecular Metabolism, Molecular Cancer Research, Journal of Lipid Research, Noncoding RNA, Experimental Eye Research, and bioRxiv. The associated research fields span cholesterol and lipid transport, autophagy, mitochondrial function, oxidative stress, breast cancer, carotenoid homeostasis, retinal biology, and addiction neuroscience.

Automatically generated from the 10 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Cell Biol; Sphingosine-1-phosphate signalling activates E-Syt1 to facilitate HDL-derived cholesterol transport; Authors - Zizhen Xu ; KD Validated
human	IF	Nat Commun; GRAMD1B is a regulator of lipid homeostasis, autophagic flux and phosphorylated tau; Authors - Diana Acosta Ingram
		Biol Psychiatry; Adaptations in Nucleus Accumbens Neuron Subtypes Mediate Negative Affective Behaviors in Fentanyl Abstinence; Authors - Megan E Fox
human	WB	Antioxidants (Basel); Aster-B Modulates Oxidative Stress Responses and Carotenoid Distribution in ARPE-19 Cells; Authors - Vidya Gopakumar
mouse	WB	Mol Metab; Aster-B coordinates with Arf1 to regulate mitochondrial cholesterol transport.; Authors - John-Paul Andersen
human	WB,IF	Mol Cancer Res; Intracellular Retention of Estradiol is Mediated by GRAM Domain-Containing Protein ASTER-B in Breast Cancer Cells; Authors - Hyung Bum Kim ; KD Validated