• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated GRAMD1B Polyclonal antibody

GRAMD1B Polyclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-24905

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC, FC (Intra)

GRAM domain containing 1B, GRAM domain-containing protein 1B, KIAA1201, Protein Aster-B, UNQ3032/PRO9834

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inA549 cells
Positive FC (Intra) detected inA549 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-24905 targets GRAMD1B in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag20670

Product name: Recombinant human GRAMD1B protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 235-504 aa of BC107480

Sequence: YVPPDDDFNTMGYCEEIPVEENEVNDSSSKSSIETKPDASPQLPKKSITNSTLTSTGSSEAPVSFDGLPLEEEALEGDGSLEKELAIDNIMGEKIEMIAPVNSPSLDFNDNEDIPTELSDSSDTHDEGEVQAFYEDLSGRQYVNEVFNFSVDKLYDLLFTNSPFQRDFMEQRRFSDIIFHPWKKEENGNQSRVILYTITLTNPLAPKTATVRETQTMYKASQESECYVIDAEVLTHDVPYHDYFYTINRYTLTRVARNKSRLRVSTELRY

Predict reactive species
Full Name GRAM domain containing 1B
Calculated Molecular Weight 738 aa, 85 kDa
Observed Molecular Weight 85 kDa
GenBank Accession NumberBC107480
Gene Symbol GRAMD1B
Gene ID (NCBI) 57476
RRIDAB_3672780
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ3KR37
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

GRAMD1B, also named as KIAA1201, contains a transmembrane region and two domains of known function; the GRAM domain and a VASt domain. It is predicted to localize in the nucleus, supported by several nuclear transport signals and nuclearly associated motifs. This highly conserved gene is found in a variety of vertebrates and invertebrates, however, it is not found in bacteria or fungi. There're some isoforms with MW 50 kDa and 81-87 kDa. With phosphor modification, it's about 90-110 kDa in WB detection.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 GRAMD1B antibody CL488-24905Download protocol
IF protocol for CL Plus 488 GRAMD1B antibody CL488-24905Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...