Product Information
25779-1-PBS targets GRIK1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag22664 Product name: Recombinant human GRIK1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 837-905 aa of BC156975 Sequence: VAIGEFIYKSRKNNDIEQCLSFNAIMEELGISLKNQKKIKKKSRTKGKSSFTSILTCHQRRTQRKETVA Predict reactive species |
| Full Name | glutamate receptor, ionotropic, kainate 1 |
| Calculated Molecular Weight | 918 aa, 104 kDa |
| Observed Molecular Weight | 95-100 kDa |
| GenBank Accession Number | BC156975 |
| Gene Symbol | GRIK1 |
| Gene ID (NCBI) | 2897 |
| RRID | AB_2880236 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P39086 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |





