Filter: AllWBIHC

WB analysis using 25779-1-AP (same clone as 25779-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 25779-1-AP (GRIK1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25779-1-PBS in a different storage buffer formulation.
IHC staining of human cerebellum using 25779-1-AP (same clone as 25779-1-PBS)
Immunohistochemical analysis of paraffin-embedded human cerebellum tissue slide using 25779-1-AP (GRIK1 antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 25779-1-PBS in a different storage buffer formulation.
IHC staining of human cerebellum using 25779-1-AP (same clone as 25779-1-PBS)
Immunohistochemical analysis of paraffin-embedded human cerebellum tissue slide using 25779-1-AP (GRIK1 antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 25779-1-PBS in a different storage buffer formulation.

GRIK1 Polyclonal antibody, PBS Only

Name: GRIK1 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 25779-1-PBS

GRIK1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 25779-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

Freight/Packing: -

Quantity

- +

25779-1-PBS targets GRIK1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag22664 Product name: Recombinant human GRIK1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 837-905 aa of BC156975 Sequence: VAIGEFIYKSRKNNDIEQCLSFNAIMEELGISLKNQKKIKKKSRTKGKSSFTSILTCHQRRTQRKETVA Predict reactive species
Full Name	glutamate receptor, ionotropic, kainate 1
Calculated Molecular Weight	918 aa, 104 kDa
Observed Molecular Weight	95-100 kDa
GenBank Accession Number	BC156975
Gene Symbol	GRIK1
Gene ID (NCBI)	2897
RRID	AB_2880236
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P39086
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Able™