GRK1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85942-1-RR (same clone as 85942-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85942-1-RR (GRK1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85942-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse retina using 85942-1-RR (same clone as 85942-1-PBS)

  mouse retina tissue were subjected to SDS PAGE followed by western blot with 85942-1-RR (GRK1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85942-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse eye using 85942-1-RR (same clone as 85942-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse eye tissue slide using 85942-1-RR (GRK1 antibody) at dilution of 1:5000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85942-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse eye using 85942-1-RR (same clone as 85942-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse eye tissue slide using 85942-1-RR (GRK1 antibody) at dilution of 1:5000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85942-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse eye using 85942-1-RR (same clone as 85942-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse eye tissue using GRK1 antibody (85942-1-RR, Clone: 250433A4 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85942-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 85942-1-RR

  Biolayer interferometry (BLl) kinetic assays of 85942-1-RR against Human GRK1 were performed. The affinity constant is 3.77 nM.

GRK1 Uni-rAb^® Recombinant Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 85942-1-PBS

Clone No.250433A4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

EC:2.7.11.14, G protein-coupled receptor kinase 1, GPRK1, Rhodopsin kinase, Rhodopsin kinase GRK1

---

Product Information

85942-1-PBS targets GRK1 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag18063

  Product name: Recombinant human GRK1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 339-563 aa of BC140945

  Sequence: AVELLDGQSKTKGYAGTPGFMAPELLQGEEYDFSVDYFALGVTLYEMIAARGPFRARGEKVENKELKHRIISEPVKYPDKFSQASKDFCEALLEKDPEKRLGFRDETCDKLRAHPLFKDLNWRQLEAGMLMPPFIPDSKTVYAKDIQDVGAFSTVKGVAFDKTDTEFFQEFATGNCPIPWQEEMIETGIFGELNVWRSDGQMPDDMKGISGGSSSSSKSGMCLVS

• Full Name: G protein-coupled receptor kinase 1
• Calculated Molecular Weight: 563 aa, 64 kDa
• Observed Molecular Weight: 64 kDa
• GenBank Accession Number: BC140945
• Gene Symbol: GRK1
• Gene ID (NCBI): 6011
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q15835
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GRK1(G protein-coupled receptor kinase 1) is also named as RHOK, RK, GPRK1, and belongs to the AGC Ser/Thr protein kinase family. It is involved in quenching of light-induced signal transduction in the phosphoreceptor. GRK1 is a photoreceptor-specific enzyme that mediates adaptation of photoreceptors to light and protects these cells against light-induced injury.