CoraLite®594-conjugated GRP75 Monoclonal antibody

GRP75 Monoclonal Antibody for IF/ICC
Cat No. CL594-67563
Clone No.2B12F2

Host / Isotype

Mouse / IgG2a

Reactivity

Human, mouse, rat

Applications

IF/ICC

CSA, GRP 75, GRP75, Heat shock 70 kDa protein 9, HSPA9, HSPA9B, Mortalin, MOT, mot 2, MOT2, MTHSP75, PBP74, Peptide binding protein 74

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite®594
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-67563 targets GRP75 in IF/ICC applications and shows reactivity with Human, mouse, rat samples.

Tested Reactivity Human, mouse, rat
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag7125

Product name: Recombinant human GRP75 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 331-679 aa of BC000478

Sequence: YLTMDSSGPKHLNMKLTRAQFEGIVTDLIRRTIAPCQKAMQDAEVSKSDIGEVILVGGMTRMPKVQQTVQDLFGRAPSKAVNPDEAVAIGAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVCQGEREMAGDNKLLGQFTLIGIPPAPRGVPQIEVTFDIDANGIVHVSAKDKGTGREQQIVIQSSGGLSKDDIENMVKNAEKYAEEDRRKKERVEAVNMAEGIIHDTETKMEEFKDQLPADECNKLKEEISKMRELLARKDSETGENIRQAASSLQQASLKLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ

Predict reactive species
Full Name heat shock 70kDa protein 9 (mortalin)
Calculated Molecular Weight 74 kDa
Observed Molecular Weight 75 kDa
GenBank Accession NumberBC000478
Gene Symbol GRP75
Gene ID (NCBI) 3313
RRIDAB_2920160
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP38646
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

GRP75 (also known as mortalin, HSPA9 or mt-Hsp70) is a constitutively expressed member of the HSPA (HSP70) family of heat-shock proteins. It is located in the mitochondrial matrix and anti-GRP75 is commonly used as the marker for mitochondria. It has been reported that GRP75 is enriched in cancer cells and contributes to carcinogenesis. In addition, decreased expression level of GRP75 has been found in neurodegenerative disorders like Parkinson's disease. (PMID: 21640711, 22920904)

Protocols

Product Specific Protocols
IF protocol for CL594 GRP75 antibody CL594-67563Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...