GS28 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• GS28 Polyclonal antibody (16106-1-AP)

GS28 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 16106-1-AP Copied!

Reviews (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

28 kDa cis-Golgi SNARE p28, 28 kDa Golgi SNARE protein, Golgi SNAP receptor complex member 1, GOS-28, GOSR1

• 

  WB analysis using 16106-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16106-1-AP (GS28 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 16106-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 16106-1-AP (GS28 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human liver using 16106-1-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 16106-1-AP (GS28 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat liver using 16106-1-AP

  rat liver tissue were subjected to SDS PAGE followed by western blot with 16106-1-AP (GS28 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 16106-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 16106-1-AP (GS28 Antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 16106-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 16106-1-AP (GS28 Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 16106-1-AP

  Immunofluorescent analysis of (10% Formaldehyde) fixed HeLa cells using 16106-1-AP (GS28 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for GS28 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HepG2 cells, human liver tissue, rat liver tissue, NIH/3T3 cells, Neuro-2a cells, PC-12 cells
• Positive IHC detected in: human stomach cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16106-1-AP targets GS28 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9021

  Product name: Recombinant human GS28 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-117 aa of BC012620

  Sequence: MAAGTSSYWEDLRKQARQLENELDLKLVSFSKLCTSYSHSSTRDGRRDRYSSDTTPLLNGSSQDRMFETMAIEIEQLLARLTGVNDKMAEYTNSAGVPSLNAALMHTLQRHRDILQV

• Full Name: golgi SNAP receptor complex member 1
• Calculated Molecular Weight: 28.6 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC012620
• Gene Symbol: GS28
• Gene ID (NCBI): 9527
• RRID: AB_2294912
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95249
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GS28, also known as GOSR1, is a 28-kDa Golgi SNARE protein that participates in ER-Golgi and intra-Golgi transport. GS28 is considered to be a core component of the Golgi SNARE complex. (PMID: 8638159)

Reviews

5.0 out of 5

1 verified customer reviews

What customers say

The single review for 16106-1-AP was posted by Boyan Zhang on January 31, 2025, for a Western Blot application using lot 00051327. The reviewer gave it a 5-star rating and commented "very good for WB," indicating strong satisfaction with the antibody's performance in Western Blot experiments.

Automatically generated from the 1 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Boyan (Verified Customer) (01-31-2025)

very good for WB

• Applications: Western Blot