Tested Applications
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL555-16106 targets GS28 in IF/ICC applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag9021 Product name: Recombinant human GS28 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-117 aa of BC012620 Sequence: MAAGTSSYWEDLRKQARQLENELDLKLVSFSKLCTSYSHSSTRDGRRDRYSSDTTPLLNGSSQDRMFETMAIEIEQLLARLTGVNDKMAEYTNSAGVPSLNAALMHTLQRHRDILQV Predict reactive species |
| Full Name | golgi SNAP receptor complex member 1 |
| Calculated Molecular Weight | 28.6 kDa |
| Observed Molecular Weight | 28 kDa |
| GenBank Accession Number | BC012620 |
| Gene Symbol | GS28 |
| Gene ID (NCBI) | 9527 |
| RRID | AB_2919629 |
| Conjugate | CoraLite®555 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 557 nm / 570nm |
| Excitation Laser | Green Laser (532 nm), Yellow-Green Laser (561 nm) |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O95249 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
GS28, also known as GOSR1, is a 28-kDa Golgi SNARE protein that participates in ER-Golgi and intra-Golgi transport. GS28 is considered to be a core component of the Golgi SNARE complex. (PMID: 8638159)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CL555 GS28 antibody CL555-16106 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The GS28 polyclonal antibody (Cat# CL555-16106) has 1 total citation. It appears in eLife, in a study investigating fusome-like structures in mouse germline cysts and their role in oocyte development. The research field is reproductive biology, specifically oogenesis and germline cell biology. The antibody was applied via immunofluorescence (IF) in mouse samples.
| Species | Application | Title |
|---|---|---|
Elife Mouse germline cysts contain a fusome-like structure that mediates oocyte development. |
