GSPT2 Recombinant monoclonal antibody, PBS Only

GSPT2 Uni-rAb® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 86508-3-PBS
Clone No.251224C9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

EC:3.6.5.-, eRF3b, Eukaryotic peptide chain release factor GTP-binding subunit ERF3B, G1 to S phase transition 2, GST2

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

86508-3-PBS targets GSPT2 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag3641

Product name: Recombinant human GSPT2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-200 aa of BC036077

Sequence: MDSGSSSSDSAPDCWDQVDMESTGSAPSGDGVSSAVAEAQREPLSSAFSRKLNVNAKPFVPNVHAAEFVPSFLRGPTQPPTLPAGSGSNDETCTGAGYPQGKRMGRGAPVEPSREEPLVSLEGSNSAVTMELSEPVVENGEVEMALEESWEHSKEVSEAEPGGGSSGDSGPPEESGQEMMEEKEEIRKSKSVIVPSGAPK

Predict reactive species
Full Name G1 to S phase transition 2
Calculated Molecular Weight 628 aa, 69 kDa
Observed Molecular Weight 69-75 kDa
GenBank Accession NumberBC036077
Gene Symbol GSPT2
Gene ID (NCBI) 23708
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ8IYD1
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

GSPT2, also named as eukaryotic peptide chain release factor GTP-binding subunit ERF3B or G1 to S phase transition protein 2 homolog, is a 628 amino acid protein, which belongs to the GTP-binding elongation factor family ERF3 subfamily. GSPT2 localizes in the cytoplasm and is highly expressed in IUCC stage II colorectal cancer (CRC). GSPT2 is involved in translation termination in response to the termination codons UAA, UAG, and UGA and may play a role as a potent stimulator of the release factor activity of ETF1. It may play a role in cell cycle progression.

Loading...
||
New chat

Able

正在加载,请稍候...