GSTM1 Monoclonal antibody, PBS Only (Detector)

• 

  WB analysis of rat liver using 67862-1-Ig (same clone as 67862-1-PBS)

  rat liver tissue were subjected to SDS PAGE followed by western blot with 67862-1-Ig (GSTM1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67862-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 67862-1-Ig (same clone as 67862-1-PBS)

  WB result of GSTM1 antibody (67862-1-Ig; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-GSTM1 transfected HeLa cells. This data was developed using the same antibody clone with 67862-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse liver using 67862-1-Ig (same clone as 67862-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 67862-1-Ig (GSTM1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67862-1-PBS in a different storage buffer formulation.

• 

  WB analysis of chicken liver using 67862-1-Ig (same clone as 67862-1-PBS)

  chicken liver tissue were subjected to SDS PAGE followed by western blot with 67862-1-Ig (GSTM1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67862-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 67862-1-Ig (same clone as 67862-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 67862-1-Ig (GSTM1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67862-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 67862-1-Ig (same clone as 67862-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 67862-1-Ig (GSTM1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67862-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig liver using 67862-1-Ig (same clone as 67862-1-PBS)

  pig liver tissue were subjected to SDS PAGE followed by western blot with 67862-1-Ig (GSTM1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67862-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 67862-1-Ig (same clone as 67862-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using GSTM1 antibody (67862-1-Ig, Clone: 3C5C2 ) at dilution of 1:800 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (RGAM002), CL594-Phalloidin (red). This data was developed using the same antibody clone with 67862-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 67862-1-Ig (same clone as 67862-1-PBS)

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug Anti-Human GSTM1 (67862-1-Ig, Clone:3C5C2) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Mouse IgG2b Isotype Control (MPC-11) (65128-1-Ig, Clone: MPC-11) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 67862-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array sample test of MP51729-1

  Cytometric bead array sample test of MP51729-1, GSTM1 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67862-2-PBS. Detection antibody: 67862-1-PBS.

• 

  Cytometric bead array standard curve of MP51729-1

  Cytometric bead array standard curve of MP51729-1, GSTM1 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67862-2-PBS. Detection antibody: 67862-1-PBS. Standard:Ag3113. Range: 0.391-50 ng/mL.

• Featured Product
• KD/KO Validated

GSTM1 Monoclonal Antibody for WB, IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA

Cat No. 67862-1-PBS

Clone No.3C5C2

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat, pig, chicken

Applications

WB, IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA

Synonyms

3C5C2, EC:2.5.1.18, glutathione S transferase mu 1, Glutathione S-transferase Mu 1, GST class mu 1

---

Product Information

67862-1-PBS targets GSTM1 as part of a matched antibody pair:

MP51729-1: 67862-2-PBS capture and 67862-1-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse, rat, pig, chicken
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3113

  Product name: Recombinant human GSTM1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-181 aa of BC024005

  Sequence: MPMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKGLEKISAYMKSSRFLPRPVFSKMAVWGNK

• Full Name: glutathione S-transferase mu 1
• Calculated Molecular Weight: 181 aa, 21 kDa
• Observed Molecular Weight: 26-28 kDa
• GenBank Accession Number: BC024005
• Gene Symbol: GSTM1
• Gene ID (NCBI): 2944
• RRID: AB_2918620
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P09488
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.