GSTM1 Monoclonal antibody, PBS Only

• 

  WB analysis of rat liver using 67862-1-Ig (same clone as 67862-1-PBS)

  rat liver tissue were subjected to SDS PAGE followed by western blot with 67862-1-Ig (GSTM1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67862-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse liver using 67862-1-Ig (same clone as 67862-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 67862-1-Ig (GSTM1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67862-1-PBS in a different storage buffer formulation.

• 

  WB analysis of chicken liver using 67862-1-Ig (same clone as 67862-1-PBS)

  chicken liver tissue were subjected to SDS PAGE followed by western blot with 67862-1-Ig (GSTM1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67862-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 67862-1-Ig (same clone as 67862-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 67862-1-Ig (GSTM1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67862-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 67862-1-Ig (same clone as 67862-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 67862-1-Ig (GSTM1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67862-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig liver using 67862-1-Ig (same clone as 67862-1-PBS)

  pig liver tissue were subjected to SDS PAGE followed by western blot with 67862-1-Ig (GSTM1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67862-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 67862-1-Ig (same clone as 67862-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using GSTM1 antibody (67862-1-Ig, Clone: 3C5C2 ) at dilution of 1:800 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (RGAM002), CL594-Phalloidin (red). This data was developed using the same antibody clone with 67862-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 67862-1-Ig (same clone as 67862-1-PBS)

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug Anti-Human GSTM1 (67862-1-Ig, Clone:3C5C2) and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Mouse IgG2b Isotype Control (MPC-11) (65128-1-Ig, Clone: MPC-11) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C). This data was developed using the same antibody clone with 67862-1-PBS in a different storage buffer formulation.

GSTM1 Monoclonal Antibody for WB, IF/ICC, FC (Intra), Indirect ELISA

Cat No. 67862-1-PBS

Clone No.3C5C2

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat, pig, chicken

Applications

WB, IF/ICC, FC (Intra), Indirect ELISA

Synonyms

GST class-mu 1, GST class mu 1, Glutathione S-transferase Mu 1, glutathione S transferase mu 1, EC:2.5.1.18

---

Product Information

67862-1-PBS targets GSTM1 in WB, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat, pig, chicken samples.

• Tested Reactivity: human, mouse, rat, pig, chicken
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3113

  Product name: Recombinant human GSTM1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-181 aa of BC024005

  Sequence: MPMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKGLEKISAYMKSSRFLPRPVFSKMAVWGNK

• Full Name: glutathione S-transferase mu 1
• Calculated Molecular Weight: 181 aa, 21 kDa
• Observed Molecular Weight: 26-28 kDa
• GenBank Accession Number: BC024005
• Gene Symbol: GSTM1
• Gene ID (NCBI): 2944
• RRID: AB_2918620
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P09488
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.