GSTM1 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• GSTM1 Monoclonal antibody (67862-1-Ig)

• Featured Product
• KD/KO Validated

GSTM1 Monoclonal Antibody for WB, IF/ICC, FC (Intra), ELISA

Cat No. 67862-1-Ig Copied!

Clone No. 3C5C2

Publications (1)

Download datasheet

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat, pig, chicken

Applications

WB, IF/ICC, FC (Intra), ELISA

Synonyms

3C5C2, EC:2.5.1.18, glutathione S transferase mu 1, Glutathione S-transferase Mu 1, GST class mu 1

• 

  WB analysis of rat liver using 67862-1-Ig

  rat liver tissue were subjected to SDS PAGE followed by western blot with 67862-1-Ig (GSTM1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 67862-1-Ig

  WB result of GSTM1 antibody (67862-1-Ig; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-GSTM1 transfected HeLa cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse liver using 67862-1-Ig

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 67862-1-Ig (GSTM1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of chicken liver using 67862-1-Ig

  chicken liver tissue were subjected to SDS PAGE followed by western blot with 67862-1-Ig (GSTM1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 67862-1-Ig

  HeLa cells were subjected to SDS PAGE followed by western blot with 67862-1-Ig (GSTM1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 67862-1-Ig

  Jurkat cells were subjected to SDS PAGE followed by western blot with 67862-1-Ig (GSTM1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of pig liver using 67862-1-Ig

  pig liver tissue were subjected to SDS PAGE followed by western blot with 67862-1-Ig (GSTM1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 67862-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using GSTM1 antibody (67862-1-Ig, Clone: 3C5C2 ) at dilution of 1:800 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (RGAM002), CL594-Phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of HeLa using 67862-1-Ig

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug Anti-Human GSTM1 (67862-1-Ig, Clone:3C5C2) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Mouse IgG2b Isotype Control (MPC-11) (65128-1-Ig, Clone: MPC-11) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for GSTM1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: rat liver tissue, chicken liver tissue, HeLa cells, Jurkat cells, mouse liver tissue, pig liver tissue
• Positive IF/ICC detected in: HeLa cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67862-1-Ig targets GSTM1 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, pig, chicken samples.

• Tested Reactivity: human, mouse, rat, pig, chicken
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3113

  Product name: Recombinant human GSTM1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-181 aa of BC024005

  Sequence: MPMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKGLEKISAYMKSSRFLPRPVFSKMAVWGNK

• Full Name: glutathione S-transferase mu 1
• Calculated Molecular Weight: 181 aa, 21 kDa
• Observed Molecular Weight: 26-28 kDa
• GenBank Accession Number: BC024005
• Gene Symbol: GSTM1
• Gene ID (NCBI): 2944
• RRID: AB_2918620
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P09488
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The GSTM1 Monoclonal antibody (3C5C2), catalog number 67862-1-Ig, has 1 total citation. It appears in Ecotoxicology and Environmental Safety (2026), a study investigating ferrostatin-1's role in alleviating organophosphate nerve agent-induced cognitive deficits via ACSL4/GPX4 and NCOA4/FTH1 pathways in guinea pig hippocampus. The associated research fields include ecotoxicology, neurotoxicology, and ferroptosis.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Ecotoxicol Environ Saf; Ferrostatin-1 inhibits ferroptosis and alleviates organophosphate nerve agent-induced cognitive deficits by regulating ACSL4/GPX4 and NCOA4/FTH1 pathways in the hippocampus of guinea pigs.; Authors - Qian Jin