GSTM3 Monoclonal antibody, PBS Only

• 

  WB analysis of HepG2 using 67634-1-Ig (same clone as 67634-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 67634-1-Ig (GSTM3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67634-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig brain using 67634-1-Ig (same clone as 67634-1-PBS)

  pig brain tissue were subjected to SDS PAGE followed by western blot with 67634-1-Ig (GSTM3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67634-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 67634-1-Ig (same clone as 67634-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 67634-1-Ig (GSTM3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67634-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 67634-1-Ig (same clone as 67634-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using GSTM3 antibody (67634-1-Ig, Clone: 1E2B8 ) at dilution of 1:1000 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67634-1-PBS in a different storage buffer formulation.

GSTM3 Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 67634-1-PBS

Clone No.1E2B8

Host / Isotype

Mouse / IgG1

Reactivity

human, pig

Applications

WB, IF/ICC, ELISA

Synonyms

1E2B8, EC:2.5.1.18, Glutathione S transferase Mu 3, Glutathione S-transferase Mu 3, GST class mu 3

---

Product Information

67634-1-PBS targets GSTM3 in WB, IF/ICC, ELISA applications and shows reactivity with human, pig samples.

• Tested Reactivity: human, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7494

  Product name: Recombinant human GSTM3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-225 aa of BC000088

  Sequence: MSCESSMVLGYWDIRGLAHAIRLLLEFTDTSYEEKRYTCGEAPDYDRSQWLDVKFKLDLDFPNLPYLLDGKNKITQSNAILRYIARKHNMCGETEEEKIRVDIIENQVMDFRTQLIRLCYSSDHEKLKPQYLEELPGQLKQFSMFLGKFSWFAGEKLTFVDFLTYDILDQNRIFDPKCLDEFPNLKAFMCRFEALEKIAAYLQSDQFCKMPINNKMAQWGNKPVC

• Full Name: glutathione S-transferase mu 3 (brain)
• Calculated Molecular Weight: 27 kDa
• Observed Molecular Weight: 27 kDa
• GenBank Accession Number: BC000088
• Gene Symbol: GSTM3
• Gene ID (NCBI): 2947
• RRID: AB_2882835
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P21266
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GSTM3 is a cytosolic enzyme involved in prostaglandin and leukotriene synthesis and in the metabolization of toxic compounds, such as chemotherapeutic drugs, insecticides, herbicides, carcinogens, and by-products of oxidative stress. GSTM3 is expressed in testis, brain, lung, and lymphocytes. GSTM3 have been reported to be dysregulated in cancers like prostate cancer and colon cancer.