GSTM3 Monoclonal antibody

• 

  WB analysis of HepG2 using 67634-1-Ig

  HepG2 cells were subjected to SDS PAGE followed by western blot with 67634-1-Ig (GSTM3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of pig brain using 67634-1-Ig

  pig brain tissue were subjected to SDS PAGE followed by western blot with 67634-1-Ig (GSTM3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 67634-1-Ig

  HeLa cells were subjected to SDS PAGE followed by western blot with 67634-1-Ig (GSTM3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of A431 using 67634-1-Ig

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using GSTM3 antibody (67634-1-Ig, Clone: 1E2B8 ) at dilution of 1:1000 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

GSTM3 Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 67634-1-Ig

Clone No.1E2B8

Publications(1)

Host / Isotype

Mouse / IgG1

Reactivity

human, pig

Applications

WB, IF/ICC, CoIP, ELISA

Synonyms

1E2B8, EC:2.5.1.18, Glutathione S transferase Mu 3, Glutathione S-transferase Mu 3, GST class mu 3

---

Tested Applications

• Positive WB detected in: HepG2 cells, HeLa cells, pig brain tissue
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IF: See 1 publications below
• CoIP: See 1 publications below

Product Information

67634-1-Ig targets GSTM3 in WB, IF/ICC, CoIP, ELISA applications and shows reactivity with human, pig samples.

• Tested Reactivity: human, pig
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7494

  Product name: Recombinant human GSTM3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-225 aa of BC000088

  Sequence: MSCESSMVLGYWDIRGLAHAIRLLLEFTDTSYEEKRYTCGEAPDYDRSQWLDVKFKLDLDFPNLPYLLDGKNKITQSNAILRYIARKHNMCGETEEEKIRVDIIENQVMDFRTQLIRLCYSSDHEKLKPQYLEELPGQLKQFSMFLGKFSWFAGEKLTFVDFLTYDILDQNRIFDPKCLDEFPNLKAFMCRFEALEKIAAYLQSDQFCKMPINNKMAQWGNKPVC

• Full Name: glutathione S-transferase mu 3 (brain)
• Calculated Molecular Weight: 27 kDa
• Observed Molecular Weight: 27 kDa
• GenBank Accession Number: BC000088
• Gene Symbol: GSTM3
• Gene ID (NCBI): 2947
• RRID: AB_2882835
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P21266
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GSTM3 is a cytosolic enzyme involved in prostaglandin and leukotriene synthesis and in the metabolization of toxic compounds, such as chemotherapeutic drugs, insecticides, herbicides, carcinogens, and by-products of oxidative stress. GSTM3 is expressed in testis, brain, lung, and lymphocytes. GSTM3 have been reported to be dysregulated in cancers like prostate cancer and colon cancer.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF,CoIP	Reprod Biol Endocrinol; A loss-of-function variant in SSFA2 causes male infertility with globozoospermia and failed oocyte activation.; Authors - Gelin Huang