CoraLite® Plus 488-conjugated GSTT1 Monoclonal antibody

GSTT1 Monoclonal Antibody for IF-P
Cat No. CL488-67645
Clone No.1A4C11

Host / Isotype

Mouse / IgG2b

Reactivity

Human, mouse

Applications

IF-P

Glutathione transferase T1 1, GST class theta 1, GSTT1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse liver tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67645 targets GSTT1 in IF-P applications and shows reactivity with Human, mouse samples.

Tested Reactivity Human, mouse
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag8573

Product name: Recombinant human GSTT1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-240 aa of BC007065

Sequence: MGLELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDACAQVNPLKKVPALKDGDFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMFPVFLGEPVSPQTLAATLAELDVTLQLLEDKFLQNKAFLTGPHISLADLVAITELMHPVGAGCQVFEGRPKLATWRQRVEAAVGEDLFQEAHEVILKAKDFPPADPTIKQKLMPWVLAMIR

Predict reactive species
Full Name glutathione S-transferase theta 1
Calculated Molecular Weight 240 aa, 27 kDa
Observed Molecular Weight 28 kDa, 30 kDa
GenBank Accession NumberBC007065
Gene Symbol GSTT1
Gene ID (NCBI) 2952
RRIDAB_2934556
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP30711
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

GSTT1 belongs to the GST superfamily and Theta family. It is a conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. GSTT1 acts on 1,2-epoxy-3-(4-nitrophenoxy)propane, phenethylisothiocyanate 4-nitrobenzyl chloride and 4-nitrophenethyl bromide. It displays glutathione peroxidase activity with cumene hydroperoxide. GSTM1 and GSTT1 has been suggested as a risk factor in various cancers. GSTT1 is important in the detoxification of unidentified xenobiotics in the large intestine.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 GSTT1 antibody CL488-67645Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...