GSTZ1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GSTZ1 Polyclonal antibody, PBS Only (14889-1-PBS)

• 

  WB analysis using 14889-1-AP (same clone as 14889-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 14889-1-AP (GSTZ1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14889-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse liver using 14889-1-AP (same clone as 14889-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 14889-1-AP (GSTZ1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14889-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 14889-1-AP (same clone as 14889-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 14889-1-AP (GSTZ1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14889-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 14889-1-AP (same clone as 14889-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 14889-1-AP (GSTZ1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14889-1-PBS in a different storage buffer formulation.

GSTZ1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 14889-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

14889-1-PBS targets GSTZ1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6676

  Product name: Recombinant human GSTZ1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-216 aa of BC001453

  Sequence: MQAGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDFQALNPMKQVPTLKIDGITIHQSLAIIEYLEEMRPTPRLLPQDPKKRASVRMISDLIAGGIQPLQNLSVLKQVGEEMQLTWAQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDLTPYPTISSINKRLLVLEAFQVSHPCRQPDTPTELRA

• Full Name: glutathione transferase zeta 1
• Calculated Molecular Weight: 24 kDa
• Observed Molecular Weight: 25-30 kDa
• GenBank Accession Number: BC001453
• Gene Symbol: GSTZ1
• Gene ID (NCBI): 2954
• RRID: AB_2116363
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43708
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Glutathione transferase zeta 1(GSTZ1) catalyzes the biotransformation of a range of α-haloacids, including dichloroacetic acid (DCA), and the penultimate step in the tyrosine degradation pathway. GSTZ1 is preferentially expressed in hepatocytes and renal proximal tubule cells where phenylalanine and tyrosine are catabolized(PMID: 16550164). This protein has 3 isoforms produced by alternative splicing.