GlyT2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GlyT2 Polyclonal antibody, PBS Only (25948-1-PBS)

• 

  WB analysis using 25948-1-AP (same clone as 25948-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 25948-1-AP (GlyT2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25948-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin cancer using 25948-1-AP (same clone as 25948-1-PBS)

  Immunohistochemical analysis of paraffin-embedded skin cancer slide using 25948-1-AP (GlyT2 antibody) at dilution of 1:100 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25948-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 25948-1-AP (same clone as 25948-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using GlyT2 antibody (25948-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 25948-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 25948-1-AP (same clone as 25948-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using GlyT2 antibody (25948-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 25948-1-PBS in a different storage buffer formulation.

GlyT2 Polyclonal Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 25948-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

SLC6A5, Sodium- and chloride-dependent glycine transporter 2, NET1, GlyT-2, GlyT 2

---

Product Information

25948-1-PBS targets GlyT2 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22835

  Product name: Recombinant human SLC6A5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-200 aa of BC096319

  Sequence: MDCSAPKEMNKLPANSPEAAAAQGHPDGPCAPRTSPEQELPAAAAPPPPRVPRSASTGAQTFQSADARACEAERPGVGSCKLSSPRAQAASAALRDLREAQGAQASPPPGSSGPGNALHCKIPSLRGPEGDANVSVGKGTLERNNTPVVGWVNMSQSTVVLGTDGITSVLPGSVATVATQEDEQGDENKARGNWSSKLDF

• Full Name: solute carrier family 6 (neurotransmitter transporter, glycine), member 5
• Calculated Molecular Weight: 797 aa, 87 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC096319
• Gene Symbol: GlyT2
• Gene ID (NCBI): 9152
• RRID: AB_3085831
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y345
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GlyT2 is a transporter protein of the SLC6 family of sodium- and chloride-dependent neurotransmitter transporters. Like other members of the family, GlyT2 is trafficked to the cell surface as homo-oligomers from the endoplasmic reticulum (ER) (PMID: 32714574). GlyT2 is expressed in medulla, and to a lesser extent in spinal cord and cerebellum. GlyT2 has 3 isoforms with the molecular mass of 63, 86 and 87 kDa. The 63 kDa band is the unglycosylated GlyT2 polypeptide, whereas the 70-110 kDa band is a differential glycosylation form of GlyT2 (PMID: 17851090, 17962467).