CoraLite® Plus 488-conjugated Glycophorin A/CD235a Polyclonal antibody

• 

  IF Staining of human placenta using CL488-15874

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human placenta tissue using CoraLite® Plus 488 Glycophorin A antibody (CL488-15874) at dilution of 1:200. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of human placenta using CL488-15874

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human placenta tissue using CoraLite® Plus 488 Glycophorin A antibody (CL488-15874) at dilution of 1:200. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

Glycophorin A/CD235a Polyclonal Antibody for IF-P

Cat No. CL488-15874

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF-P

Synonyms

Glycophorin A, CD235a, GpMiIII, GPErik, GPA

---

Tested Applications

• Positive IF-P detected in: human placenta tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-15874 targets Glycophorin A/CD235a in IF-P applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8635

  Product name: Recombinant human GYPA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 24-150 aa of BC005319

  Sequence: EVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPEITLIIFGVMAGVIGTILLISYGIRRLIKKSPSDVKPLPSPDTDVPLSSVEIENPETSDQ

• Full Name: glycophorin A (MNS blood group)
• Calculated Molecular Weight: 150 aa, 16 kDa
• Observed Molecular Weight: 36-38 kDa
• GenBank Accession Number: BC005319
• Gene Symbol: Glycophorin A
• Gene ID (NCBI): 2993
• RRID: AB_3672641
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P02724
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Glycophorin A (GYPA) is the major transmembrane sialoglycoprotein in erythrocytes. It is a dimeric type I transmembrane protein carrying 15 closely clustered O-linked tetrasaccharides capped with sialic acid/N-acetylneuraminic acid (Neu5Ac). This 36 kDa protein represents the major sialoglycoprotein of the red blood cell membrane displaying about one million copies per cell. (PMID: 9490702)