Biotin Anti-Mouse Glycophorin A/CD235a Rabbit Recombinant Antibody

• 

  FC experiment of mouse bone marrow cells using Biotin-98269

  1x10^6 mouse bone marrow cells were surface stained with 0.25 ug Biotin Anti-Mouse Glycophorin A/CD235a Rabbit RecAb (Biotin-98269, Clone: 242129D10) or Biotin Rabbit IgG Isotype Control Recombinant Antibody (Biotin-98136, Clone: 240953C9), and Streptavidin-PE Conjugate (PE-PF00030). Cells were co-stained with CoraLite® Plus 647 Anti-Mouse CD45 (30-F11) (CL647-65087, Clone: 30-F11). Cells were not fixed.

• 

  FC experiment of mouse bone marrow cells using Biotin-98269

  1x10^6 mouse bone marrow cells were surface stained with 0.25 ug Biotin Anti-Mouse Glycophorin A/CD235a Rabbit RecAb (Biotin-98269, Clone: 242129D10) (red) or Biotin Rabbit IgG Isotype Control Recombinant Antibody (Biotin-98136, Clone: 240953C9) (blue), and Streptavidin-PE Conjugate (PE-PF00030). Cells were not fixed.

Glycophorin A/CD235a Uni-rAb^® Recombinant Antibody for FC

Cat No. Biotin-98269

Clone No.242129D10

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Synonyms

glycophorin A, 242129D10, CD235a, Glycophorin-A, GPA

---

Tested Applications

• Positive FC detected in: mouse bone marrow cells

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

Biotin-98269 targets Glycophorin A/CD235a in FC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1886

  Product name: Recombinant Mouse Glycophorin A protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 1-108 aa of NM_010369.3

  Sequence: MTESTAAVTTSGHSLTTTFHIPSSQHYQEEHSPSLSGSDSLLQITTPVVASTVGNPNQHSATMSTPAIHVSTYHTAPTEVSAAFEEQPVSPHIGGMPSPIQHDFPALV

• Full Name: glycophorin A
• Calculated Molecular Weight: 18kDa
• GenBank Accession Number: NM_010369.3
• Gene Symbol: Gypa
• Gene ID (NCBI): 14934
• Conjugate: Biotin
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P14220
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

Glycophorin A (GYPA), also known as CD235a, is the major transmembrane sialoglycoprotein in erythrocytes. It is a dimeric type I transmembrane protein carrying 15 closely clustered O-linked tetrasaccharides capped with sialic acid/N-acetylneuraminic acid (Neu5Ac). This 36 kDa protein represents the major sialoglycoprotein of the red blood cell membrane displaying about one million copies per cell. (PMID: 9490702)