Glypican 6 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Glypican 6 Polyclonal antibody, PBS Only (21526-1-PBS)

• 

  WB analysis using 21526-1-AP (same clone as 21526-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21526-1-AP (Glypican 6 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21526-1-PBS in a different storage buffer formulation.

Glypican 6 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 21526-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

GPC6, Secreted glypican-6, UNQ369/PRO705

---

Product Information

21526-1-PBS targets Glypican 6 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16135

  Product name: Recombinant human GPC6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 213-278 aa of BC106947

  Sequence: RAFIAARTFVQGLTVGREVANRVSKVSPTPGCIRALMKMLYCPYCRGLPTVRPCNNYCLNVMKGCL

• Full Name: glypican 6
• Calculated Molecular Weight: 555 aa, 63 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC106947
• Gene Symbol: GPC6
• Gene ID (NCBI): 10082
• RRID: AB_3742041
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y625
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Glypican-6 (GPC6) is a glycosylphosphatidylinositol-anchored heparan-sulfate proteoglycan that regulates cell-surface signaling cues during development and disease. GPC6 binds Hedgehog ligands and facilitates their interaction with the receptor Patched, thereby amplifying Hh signaling required for long-bone and gastric/intestinal elongation. (PMID: 35235423)