CoraLite® Plus 647 Anti-Mouse GM-CSF Rabbit Recombinant Antibody

GM-CSF Uni-rAb® Recombinant Antibody for FC (Intra)
Cat No. CL647-98014
Clone No.230286E11

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC (Intra)

Csf2, 230286E11, Colony Stimulating Factor 2, CSF 2, Csfgm

Formulation:  PBS, Azide
PBS, Azide
Conjugate:  CoraLite® Plus 647
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inPMA and ionomycin stimulated C57BL/6 CD3 T cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in 100 μl suspension
This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL647-98014 targets GM-CSF in FC (Intra) applications and shows reactivity with mouse samples.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0512

Product name: Recombinant Mouse GM-CSF protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: N-6*HIS

Domain: 18-141 aa of NM-009969

Sequence: APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPGQK

Predict reactive species
Full Name colony stimulating factor 2 (granulocyte-macrophage)
GenBank Accession NumberNM-009969
Gene Symbol GM-CSF
Gene ID (NCBI) 12981
RRIDAB_3673657
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP01587
Storage Buffer PBS with 0.09% sodium azide, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

Gm-csf, also known as Csf2, is a monomeric glycoprotein secreted by macrophages, T cells, mast cells, NK cells, endothelial cells and fibroblasts that functions as a cytokine. Gm-csf was first characterized as a hematopoietic growth factor that stimulates the proliferation of myeloid cells from bone-marrow progenitors. Gm-csf is now recognized as an important activating and differentiation factor for immune cells, and is essential for a wide range of biological processes in both innate and adaptive immunity. Gm-csf has been shown to protect against pulmonary infection and intestinal inflammation, and it is necessary for normal pulmonary and colon homeostasis.

Protocols

Product Specific Protocols
FC protocol for CL Plus 647 GM-CSF antibody CL647-98014Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...