CoraLite®594 Anti-Human Granzyme B Rabbit Recombinant Antibody

Granzyme B Uni-rAb® Recombinant Antibody for FC (Intra)
Cat No. CL594-98070
Clone No.240761G4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC (Intra)

GZMB, 240761G4, Cathepsin G-like 1, CCPI, CGL 1

Formulation:  PBS, Azide, BSA
PBS, Azide, BSA
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inhuman PBMCs

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 5 ul per 10^6 cells in 100 μl suspension
This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-98070 targets Granzyme B in FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0592

Product name: Recombinant Human Granzyme B protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-10*HIS

Domain: 19-247 aa of BC030195

Sequence: GEIIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVLTAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRY

Predict reactive species
Full Name granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1)
Calculated Molecular Weight 247 aa, 28 kDa
GenBank Accession NumberBC030195
Gene Symbol Granzyme B
Gene ID (NCBI) 3002
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP10144
Storage Buffer PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

GZMB (Granzyme B) is also named as CGL1, CSPB, CTLA1, GRB and belongs to the Granzyme subfamily. This enzyme is necessary for target cell lysis in cell-mediated immune responses. The cytotoxic lymphocyte protease granzyme B can promote apoptosis through direct processing and activation of members of the caspase family. Granzyme B can also cleave the BH3-only protein, BID, to promote caspase-independent mitochondrial permeabilization (PMID:17283187). Granzyme B induces lamin B degradation in isolated nuclei less efficiently than Granzyme A (PMID:11331782).

Protocols

Product Specific Protocols
FC protocol for CL594 Granzyme B antibody CL594-98070Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...