• Featured Product
  • KD/KO Validated

HADHA Monoclonal antibody, PBS Only (Capture)

HADHA Monoclonal Antibody for WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA
Cat No. 60250-1-PBS
Clone No.3E9B1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA

3E9B1, 78 kDa gastrin binding protein, 78 kDa gastrin-binding protein, EC:2.3.1.-, ECHA

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

60250-1-PBS targets HADHA as part of a matched antibody pair:

MP50412-1: 60250-1-PBS capture and 60250-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag1211

Product name: Recombinant human HADHA protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 339-763 aa of BC009235

Sequence: LMGLYHGQVLCKKNKFGAPQKDVKHLAILGAGLMGAGIAQVSVDKGLKTILKDATLTALDRGQQQVFKGLNDKVKKKALTSFERDSIFSNLTGQLDYQGFEKADMVIEAVFEDLSLKHRVLKEVEAVIPDHCIFASNTSALPISEIAAVSKRPEKVIGMHYFSPVDKMQLLEIITTEKTSKDTSASAVAVGLKQGKVIIVVKDGPGFYTTRCLAPMMSEVIRILQEGVDPKKLDSLTTSFGFPVGAATLVDEVGVDVAKHVAEDLGKVFGERFGGGNPELLTQMVSKGFLGRKSGKGFYIYQEGVKRKDLNSDMDSILASLKLPPKSEVSSDEDIQFRLVTRFVNEAVMCLQEGILATPAEGDIGAVFGLGFPPCLGGPFRFVDLYGAQKIVDRLKKYEAAYGKQFTPCQLLADHANSPNKKFYQ

Predict reactive species
Full Name hydroxyacyl-Coenzyme A dehydrogenase/3-ketoacyl-Coenzyme A thiolase/enoyl-Coenzyme A hydratase (trifunctional protein), alpha subunit
Calculated Molecular Weight 83 kDa
Observed Molecular Weight 79 kDa
GenBank Accession NumberBC009235
Gene Symbol HADHA
Gene ID (NCBI) 3030
RRIDAB_2881371
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP40939
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

HADHA(Trifunctional enzyme subunit alpha, mitochondrial) is also named as HADH,78 kDa gastrin-binding protein.It belongs to the enoyl-CoA hydratase/isomerase family in the N-terminal section and the 3-hydroxyacyl-CoA dehydrogenase family in the central section.It harbors the 3-hydroxyacyl-CoA dehydrogenase and enoyl-CoA hydratase activities.Defects in HADHA are a cause of trifunctional protein deficiency (TFP deficiency) and long-chain 3-hydroxyl-CoA dehydrogenase deficiency (LCHAD deficiency) and maternal acute fatty liver of pregnancy (AFLP).

Loading...
||
New chat

Able

正在加载,请稍候...