• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated HADHA Monoclonal antibody

HADHA Monoclonal Antibody for IF/ICC
Cat No. CL488-60250
Clone No.3E9B1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

IF/ICC

78 kDa gastrin binding protein, ECHA, GBP, HADH, HADHA, LCHAD, MTPA, TP ALPHA

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-60250 targets HADHA in IF/ICC applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag1211

Product name: Recombinant human HADHA protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 339-763 aa of BC009235

Sequence: LMGLYHGQVLCKKNKFGAPQKDVKHLAILGAGLMGAGIAQVSVDKGLKTILKDATLTALDRGQQQVFKGLNDKVKKKALTSFERDSIFSNLTGQLDYQGFEKADMVIEAVFEDLSLKHRVLKEVEAVIPDHCIFASNTSALPISEIAAVSKRPEKVIGMHYFSPVDKMQLLEIITTEKTSKDTSASAVAVGLKQGKVIIVVKDGPGFYTTRCLAPMMSEVIRILQEGVDPKKLDSLTTSFGFPVGAATLVDEVGVDVAKHVAEDLGKVFGERFGGGNPELLTQMVSKGFLGRKSGKGFYIYQEGVKRKDLNSDMDSILASLKLPPKSEVSSDEDIQFRLVTRFVNEAVMCLQEGILATPAEGDIGAVFGLGFPPCLGGPFRFVDLYGAQKIVDRLKKYEAAYGKQFTPCQLLADHANSPNKKFYQ

Predict reactive species
Full Name hydroxyacyl-Coenzyme A dehydrogenase/3-ketoacyl-Coenzyme A thiolase/enoyl-Coenzyme A hydratase (trifunctional protein), alpha subunit
Calculated Molecular Weight 83 kDa
GenBank Accession NumberBC009235
Gene Symbol HADHA
Gene ID (NCBI) 3030
RRIDAB_2883125
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP40939
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

HADHA(Trifunctional enzyme subunit alpha, mitochondrial) is also named as HADH,78 kDa gastrin-binding protein.It belongs to the enoyl-CoA hydratase/isomerase family in the N-terminal section and the 3-hydroxyacyl-CoA dehydrogenase family in the central section.It harbors the 3-hydroxyacyl-CoA dehydrogenase and enoyl-CoA hydratase activities.Defects in HADHA are a cause of trifunctional protein deficiency (TFP deficiency) and long-chain 3-hydroxyl-CoA dehydrogenase deficiency (LCHAD deficiency) and maternal acute fatty liver of pregnancy (AFLP).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 HADHA antibody CL488-60250Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...