HAND1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• HAND1 Polyclonal antibody, PBS Only (10882-1-PBS)

• 

  WB analysis using 10882-1-AP (same clone as 10882-1-PBS)

  SH-SY5Y (positive) and HeLa (negative) cells were subjected to SDS PAGE followed by western blot with 10882-1-AP (HAND1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10882-1-PBS in a different storage buffer formulation.

HAND1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 10882-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

bHLHa27, Class A basic helix-loop-helix protein 27, eHAND, Extraembryonic tissues, heart, autonomic nervous system and neural crest derivatives-expressed protein 1, Heart- and neural crest derivatives-expressed protein 1

---

Product Information

10882-1-PBS targets HAND1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1324

  Product name: Recombinant human HAND1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-215 aa of BC021190

  Sequence: MNLVGSYAHHHHHHHPHPAHPMLHEPFLFGPASRCHQERPYFQSWLLSPADAAPDFPAGGPPPAAAAAATAYGPDARPGQSPGRLEALGGRLGRRKGSGPKKERRRTESINSAFAELRECIPNVPADTKLSKIKTLRLATSYIAYLMDVLAKDAQSGDPEAFKAELKKADGGRESKRKRELQQHEGFPPALGPVEKRIKGRTGWPQQVWALELNQ

• Full Name: heart and neural crest derivatives expressed 1
• Calculated Molecular Weight: 24 kDa
• Observed Molecular Weight: 24 kDa
• GenBank Accession Number: BC021190
• Gene Symbol: HAND1
• Gene ID (NCBI): 9421
• RRID: AB_3741815
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O96004
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The HAND1 gene encodes a basic helix-loop-helix (bHLH) transcription factor essential for mammalian heart development (PMID:19586923). HAND1 is highly expressed in the heart and in cytotrophoblastic cell lines, and is required in the adult for sustained expression of cardiac-specific genes (PMID:9931445).