HAT1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• HAT1 Polyclonal antibody, PBS Only (11432-1-PBS)

• 

  WB analysis using 11432-1-AP (same clone as 11432-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 11432-1-AP (HAT1 antibody) at dilution of 1:15000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11432-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 11432-1-AP (same clone as 11432-1-PBS)

  WB result of HAT1 antibody (11432-1-AP; 1:8000; incubated at room temperature for 1.5 hours) with sh-Control and sh-HAT1 transfected HEK-293 cells. This data was developed using the same antibody clone with 11432-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HepG2 using 11432-1-AP (same clone as 11432-1-PBS)

  IP result of anti-HAT1 (IP:11432-1-AP, 4ug; Detection:11432-1-AP 1:500) with HepG2 cells lysate 3200ug. This data was developed using the same antibody clone with 11432-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 11432-1-AP (same clone as 11432-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 11432-1-AP (HAT1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11432-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 11432-1-AP (same clone as 11432-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 11432-1-AP (HAT1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11432-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse colon using 11432-1-AP (same clone as 11432-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 11432-1-AP (HAT1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11432-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse ovary using 11432-1-AP (same clone as 11432-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse ovary tissue using HAT1 antibody (11432-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 11432-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 11432-1-AP (same clone as 11432-1-PBS)

  Immunofluorescent analysis of HepG2 cells, using HAT1 antibody 11432-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). This data was developed using the same antibody clone with 11432-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

HAT1 Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, IP, Indirect ELISA

Cat No. 11432-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IF-P, IP, Indirect ELISA

Synonyms

EC:2.3.1.48, KAT1

---

Product Information

11432-1-PBS targets HAT1 in WB, IHC, IF/ICC, IF-P, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1952

  Product name: Recombinant human HAT1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 241-419 aa of BC018682

  Sequence: MLILTPFQGQGHGAQLLETVHRYYTEFPTVLDITAEDPSKSYVKLRDFVLVKLCQDLPCFSREKLMQGFNEDMAIEAQQKFKINKQHARRVYEILRLLVTDMSDAEQYRSYRLDIKRRLISPYKKKQRDLAKMRKCLRPEELTNQMNQIEISMQHEQLEESFQELVEDYRRVIERLAQE

• Full Name: histone acetyltransferase 1
• Calculated Molecular Weight: 419 aa, 50 kDa
• Observed Molecular Weight: 46 kDa
• GenBank Accession Number: BC018682
• Gene Symbol: HAT1
• Gene ID (NCBI): 8520
• RRID: AB_2116435
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O14929
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.