HBS1L Monoclonal antibody

• 

  WB analysis using 68146-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68146-1-Ig (HBS1L antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control.

• 

  WB analysis using 68146-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68146-1-Ig (HBS1L antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 68146-1-Ig

  HepG2 cells were subjected to SDS PAGE followed by western blot with 68146-1-Ig (HBS1L antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 68146-1-Ig

  WB result of HBS1L antibody (68146-1-Ig; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-HBS1L transfected HEK-293 cells.

• 

  IF Staining of U2OS using 68146-1-Ig

  Immunofluorescent analysis of (-20°C Methanol) fixed U2OS cells using HBS1L antibody (68146-1-Ig, Clone: 1A10C4 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L).

• 

  IF Staining of U2OS using 68146-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed U2OS cells using HBS1L antibody (68146-1-Ig, Clone: 1A10C4 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L).

• Featured Product
• KD/KO Validated

HBS1L Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 68146-1-Ig

Clone No.1A10C4

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

WB, IF/ICC, ELISA

Synonyms

DKFZp686L13262, EF 1a, ERFS, HBS1, HBS1 like (S. cerevisiae), HBS1 like protein, HBS1L, HSPC276, KIAA1038

---

Tested Applications

• Positive WB detected in: NCI-H1299 cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells, LNCaP cells, HeLa cells
• Positive IF/ICC detected in: U2OS cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

68146-1-Ig targets HBS1L in WB, IF/ICC, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0388

  Product name: Recombinant human HBS1L protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 43-262 aa of BC001465

  Sequence: SRRDKPSVEPVEEYDYEDLKESSNSVSNHQLSGFDQARLYSCLDHMREVLGDAVPDEILIEAVLKNKFDVQKALSGVLEQDRVQSLKDKNEATVSTGKIAKGKPVDSQTSRSESEIVPKVAKMTVSGKKQTMGFEVPGVSSEENGHSFHTPQKGPPIEDAIASSDVLETASKSANPPHTIQASEEQSSTPAPVKKSGKLRQQIDVKAELEKRQGGKQLLN

• Full Name: HBS1-like (S. cerevisiae)
• Calculated Molecular Weight: 75 kDa
• Observed Molecular Weight: 75 kDa
• GenBank Accession Number: BC001465
• Gene Symbol: HBS1L
• Gene ID (NCBI): 10767
• RRID: AB_2923670
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9Y450
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HBS1L (HBS1-like), also known as EF-1a or ERFS, is a 684 amino acid protein that belongs to the GTP-binding elongation factor family and exists as multiple alternatively spliced isoforms. Expressed in kidney, brain, heart, placenta, liver, muscle and pancreas, HSB1L is thought to play a role in controlling fetal hemoglobin levels, specifically influencing platelet, monocyte and erythrocyte hemoglobin content. The gene encoding HBS1L maps to a locus on human chromosome 6 that is associated with sickle cell anemia and beta-thalassemia, suggesting a role for HBS1L in the pathogenesis of blood disorders.This antibody specifically recognizes the 75kd human HBS1L protein.