• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated HBS1L Monoclonal antibody

HBS1L Monoclonal Antibody for IF/ICC
Cat No. CL488-68146
Clone No.1A10C4

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

IF/ICC

DKFZp686L13262, EF 1a, ERFS, HBS1, HBS1 like (S. cerevisiae), HBS1 like protein, HBS1L, HSPC276, KIAA1038

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inU2OS cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-68146 targets HBS1L in IF/ICC applications and shows reactivity with Human samples.

Tested Reactivity Human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag0388

Product name: Recombinant human HBS1L protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 43-262 aa of BC001465

Sequence: SRRDKPSVEPVEEYDYEDLKESSNSVSNHQLSGFDQARLYSCLDHMREVLGDAVPDEILIEAVLKNKFDVQKALSGVLEQDRVQSLKDKNEATVSTGKIAKGKPVDSQTSRSESEIVPKVAKMTVSGKKQTMGFEVPGVSSEENGHSFHTPQKGPPIEDAIASSDVLETASKSANPPHTIQASEEQSSTPAPVKKSGKLRQQIDVKAELEKRQGGKQLLN

Predict reactive species
Full Name HBS1-like (S. cerevisiae)
Calculated Molecular Weight 75 kDa
Observed Molecular Weight75 kDa
GenBank Accession NumberBC001465
Gene Symbol HBS1L
Gene ID (NCBI) 10767
RRIDAB_3084417
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9Y450
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

HBS1L (HBS1-like), also known as EF-1a or ERFS, is a 684 amino acid protein that belongs to the GTP-binding elongation factor family and exists as multiple alternatively spliced isoforms. Expressed in kidney, brain, heart, placenta, liver, muscle and pancreas, HSB1L is thought to play a role in controlling fetal hemoglobin levels, specifically influencing platelet, monocyte and erythrocyte hemoglobin content. The gene encoding HBS1L maps to a locus on human chromosome 6 that is associated with sickle cell anemia and beta-thalassemia, suggesting a role for HBS1L in the pathogenesis of blood disorders.This antibody specifically recognizes the 75kd human HBS1L protein.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 HBS1L antibody CL488-68146Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...